• Gene id: 9535

Gene Summary

• Gene Symbol: GMFG   Gene   UCSC   Ensembl
• Aliases: GMF-GAMMA
• Gene name: glia maturation factor gamma
• Alternate names: glia maturation factor gamma,
• Gene location: 19q13.2 (39336042: 39328358)     Exons: 7     NC_000019.10

Protein Summary

• Protein general information: O60234  
  • Name: Glia maturation factor gamma (GMF gamma)
  • Length: 142  
  • Mass: 16801
  • Tissue specificity: Expressed predominantly in lung, heart and placenta.
• Sequence:

  MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKY
  VHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

• Structural information:
  • Protein Domains: (4..13-)
    (/note="ADF-H-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00599"-)
  • Interpro: IPR002108  IPR029006  IPR011171  IPR030076  
  • Prosite: PS51263
  • CDD: cd11283
  • PDB: 3L50
  • PDBsum: 3L50
  • STRING: ENSP00000472249
• Other Databases: GeneCards:  GMFG  Malacards:  GMFG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071846	actin filament debranching	IBA	biological process
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0071933	Arp2/3 complex binding	IEA	molecular function
GO:2000249	regulation of actin cytoskeleton reorganization	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0004860	protein kinase inhibitor activity	TAS	molecular function
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0071846	actin filament debranching	IEA	biological process
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenoozoospermia	MIK: 32167074

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
32167074	Asthenoozoospermia			12 (6controls, 6 cases)	Male infertility	Microarray