• Gene id: 9531

Gene Summary

• Gene Symbol: BAG3   Gene   UCSC   Ensembl
• Aliases: BAG-3, BIS, CAIR-1, MFM6
• Gene name: BAG cochaperone 3
• Alternate names: BAG family molecular chaperone regulator 3, BCL2 associated athanogene 3, BCL2-binding athanogene 3, bcl-2-binding protein Bis, docking protein CAIR-1,
• Gene location: 10q26.11 (119651379: 119677818)     Exons: 4     NC_000010.11
• Gene summary(Entrez): BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein
• OMIM: 603883

Protein Summary

• Protein general information: O95817  
  • Name: BAG family molecular chaperone regulator 3 (BAG 3) (Bcl 2 associated athanogene 3) (Bcl 2 binding protein Bis) (Docking protein CAIR 1)
  • Length: 575  
  • Mass: 61595
• Sequence:

  MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPSREGSR
  LPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRGMPETTQPDKQ
  CGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSF
  HQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVD
  RPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSEKVEVKVPPAPVPCPP
  PSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKK
  YLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIM
  EMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP

• Structural information:
  • Protein Domains: (20..5-)
    (/note="WW-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (124..15-)
    (/note="WW-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (421..49-)
    (/note="BAG-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00369"-)
  • Interpro: IPR039773  IPR036533  IPR003103  IPR001202  IPR036020  
  • Prosite: PS51035 PS01159 PS50020
  • CDD: cd00201
  • DIP: 41273
  • STRING: ENSP00000358081
• Other Databases: GeneCards:  BAG3  Malacards:  BAG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0101031	chaperone complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050821	protein stabilization	IDA	biological process
GO:0051087	chaperone binding	IPI	molecular function
GO:0045505	dynein intermediate chain binding	NAS	molecular function
GO:0098840	protein transport along microtubule	TAS	biological process
GO:0016235	aggresome	TAS	cellular component
GO:1905337	positive regulation of aggrephagy	IMP	biological process
GO:0010664	negative regulation of striated muscle cell apoptotic process	IMP	biological process
GO:0046716	muscle cell cellular homeostasis	IMP	biological process
GO:0070842	aggresome assembly	TAS	biological process
GO:0034620	cellular response to unfolded protein	IMP	biological process
GO:0072321	chaperone-mediated protein transport	TAS	biological process
GO:0034605	cellular response to heat	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000774	adenyl-nucleotide exchange factor activity	IDA	molecular function
GO:0042307	positive regulation of protein import into nucleus	IMP	biological process
GO:0046827	positive regulation of protein export from nucleus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0097201	negative regulation of transcription from RNA polymerase II promoter in response to stress	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051087	chaperone binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0000774	adenyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0021510	spinal cord development	IEA	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0046716	muscle cell cellular homeostasis	IEA	biological process
GO:0010664	negative regulation of striated muscle cell apoptotic process	IEA	biological process
GO:1903215	negative regulation of protein targeting to mitochondrion	IEA	biological process
GO:0061684	chaperone-mediated autophagy	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0001725	stress fiber	IEA	cellular component
GO:0000045	autophagosome assembly	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0030018	Z disc	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0006457	protein folding	NAS	biological process

Diseases

Associated diseases	References
Myofibrillar myopathies	KEGG:H00595
Myofibrillar myopathies	KEGG:H00595
pancreatic cancer	PMID:11513873
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881