Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 9530
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol BAG4   Gene   UCSC   Ensembl
Aliases BAG-4, SODD
Gene name BAG cochaperone 4
Alternate names BAG family molecular chaperone regulator 4, BCL2 associated athanogene 4, bcl-2-associated athanogene 4, silencer of death domains,
Gene location 8p11.23 (38176854: 38213300)     Exons: 5     NC_000008.11
Gene summary(Entrez) The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroi
OMIM 603884

Protein Summary
Protein general information O95429  

Name: BAG family molecular chaperone regulator 4 (BAG 4) (Bcl 2 associated athanogene 4) (Silencer of death domains)

Length: 457  Mass: 49594

Tissue specificity: Ubiquitous.

Sequence MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPS
GGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTYPPGPGANTAS
YSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPSQNPGMTLPHYPYGDG
NRSVPQSGPTVRPQEDAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPSSGSPQSPPSPPVQQPKDSSY
PYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQDQSSSLPEECVPSDES
TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILE
KLEKKGL
Structural information
Protein Domains
 (379..45-)
(/note="BAG-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00369"-)
Interpro:  IPR039773  IPR036533  IPR003103  
Prosite:   PS51035

PDB:  		 1M62 1M7K
PDBsum:   1M62 1M7K
MINT:  
STRING:   ENSP00000287322
Other Databases GeneCards:  BAG4  Malacards:  BAG4

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:1903215 negative regulation of pr
otein targeting to mitoch
ondrion
 IMP biological process
GO:0051087 chaperone binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0006457 protein folding
 TAS biological process
GO:0043066 negative regulation of ap
optotic process
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0033209 tumor necrosis factor-med
iated signaling pathway
 TAS biological process
GO:1900034 regulation of cellular re
sponse to heat
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:2001145 negative regulation of ph
osphatidylinositol-3,4,5-
trisphosphate 5-phosphata
se activity
 IEA biological process
GO:0097178 ruffle assembly
 IEA biological process
GO:0072659 protein localization to p
lasma membrane
 IEA biological process
GO:0051496 positive regulation of st
ress fiber assembly
 IEA biological process
GO:0071364 cellular response to epid
ermal growth factor stimu
lus
 IEA biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
 IEA biological process
GO:0045785 positive regulation of ce
ll adhesion
 IEA biological process
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
 IEA biological process
GO:0030838 positive regulation of ac
tin filament polymerizati
on
 IEA biological process
GO:0010763 positive regulation of fi
broblast migration
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0071356 cellular response to tumo
r necrosis factor
 IDA biological process
GO:0005829 cytosol
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0003723 RNA binding
 HDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04668TNF signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
pancreatic cancer PMID:10799310
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
31037746 Spermatoge
nic defect
s
16 (1 control,
15 cases)
 Male infertility GSE6023 analyzed using GEO2R
 Show abstract