• Gene id: 9529

Gene Summary

• Gene Symbol: BAG5   Gene   UCSC   Ensembl
• Aliases: BAG-5
• Gene name: BAG cochaperone 5
• Alternate names: BAG family molecular chaperone regulator 5, BCL2 associated athanogene 5, bcl-2-associated athanogene 5,
• Gene location: 14q32.33 (81683923: 81681164)     Exons: 6     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroi
• OMIM: 603885

Protein Summary

• Protein general information: Q9UL15  
  • Name: BAG family molecular chaperone regulator 5 (BAG 5) (Bcl 2 associated athanogene 5)
  • Length: 447  
  • Mass: 51200
• Sequence:

  MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKRAAQET
  ERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTGGKISLRKARY
  HTLTKICAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNNETCRHLSCVLSGLIA
  DLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQNPS
  ELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKEALEKRKLFACEEHPSHKAVWNVLGN
  LSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY

• Structural information:
  • Protein Domains: (9..8-)
    (/note="BAG-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00369-)
    (95..16-)
    (/note="BAG-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00369-)
    (182..26-)
    (/note="BAG-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00369-)
    (-)
  • Interpro: IPR039773  IPR036533  IPR003103  
  • Prosite: PS51035
  • PDB: 2D9D 3A8Y
  • PDBsum: 2D9D 3A8Y
  • DIP: 53428
  • STRING: ENSP00000338814
• Other Databases: GeneCards:  BAG5  Malacards:  BAG5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050821	protein stabilization	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0051438	regulation of ubiquitin-protein transferase activity	TAS	biological process
GO:0031397	negative regulation of protein ubiquitination	IMP	biological process
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0006457	protein folding	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	ISS	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0031397	negative regulation of protein ubiquitination	ISS	biological process
GO:0051444	negative regulation of ubiquitin-protein transferase activity	ISS	biological process
GO:0090083	regulation of inclusion body assembly	IMP	biological process
GO:0016234	inclusion body	IDA	cellular component
GO:0061084	negative regulation of protein refolding	ISS	biological process
GO:0070997	neuron death	ISS	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)