• Gene id: 9528

Gene Summary

• Gene Symbol: TMEM59   Gene   UCSC   Ensembl
• Aliases: C1orf8, DCF1, HSPC001, PRO195, UNQ169
• Gene name: transmembrane protein 59
• Alternate names: transmembrane protein 59, dendritic cell factor 1, liver membrane-bound protein,
• Gene location: 1p32.3 (54053572: 54026680)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein shown to regulate autophagy in response to bacterial infection. This protein may also regulate the retention of amyloid precursor protein (APP) in the Golgi apparatus through its control of APP glycosylation. Overexpression of
• OMIM: 617084

Protein Summary

• Protein general information: Q9BXS4  
  • Name: Transmembrane protein 59 (Liver membrane bound protein)
  • Length: 323  
  • Mass: 36223
• Sequence:

  MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYACQRGCR
  LFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHLLFPLTLVRSF
  WSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDG
  ESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDLEFMNEQKLNRYPASSLVVVR
  SKTEDHEEAGPLPTKVNLAHSEI

• Structural information:
  • Interpro: IPR022065  
  • STRING: ENSP00000234831
• Other Databases: GeneCards:  TMEM59  Malacards:  TMEM59

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0005770	late endosome	IBA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004175	endopeptidase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0010955	negative regulation of protein processing	IDA	biological process
GO:0005797	Golgi medial cisterna	IDA	cellular component
GO:0000138	Golgi trans cisterna	IDA	cellular component
GO:0000137	Golgi cis cisterna	IDA	cellular component
GO:1903077	negative regulation of protein localization to plasma membrane	IDA	biological process
GO:0090285	negative regulation of protein glycosylation in Golgi	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881