• Gene id: 9527

Gene Summary

• Gene Symbol: GOSR1   Gene   UCSC   Ensembl
• Aliases: GOLIM2, GOS-28, GOS28, GOS28/P28, GS28, P28
• Gene name: golgi SNAP receptor complex member 1
• Alternate names: Golgi SNAP receptor complex member 1, 28 kDa Golgi SNARE protein, 28 kDa cis-Golgi SNARE p28, Golgi SNARE 28 kDa, cis-golgi SNARE, golgi integral membrane protein 2,
• Gene location: 17q11.2 (30477401: 30527591)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternat
• OMIM: 604026

Protein Summary

• Protein general information: O95249  
  • Name: Golgi SNAP receptor complex member 1 (28 kDa Golgi SNARE protein) (28 kDa cis Golgi SNARE p28) (GOS 28)
  • Length: 250  
  • Mass: 28613
• Sequence:

  MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIE
  QLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYK
  SGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLR
  KRRDSLILGGVIGICTILLLLYAFH

• Structural information:
  • Interpro: IPR023601  
  • STRING: ENSP00000225724
• Other Databases: GeneCards:  GOSR1  Malacards:  GOSR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005484	SNAP receptor activity	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0031201	SNARE complex	TAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0005797	Golgi medial cisterna	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0000139	Golgi membrane	IBA	cellular component
GO:0005801	cis-Golgi network	IBA	cellular component
GO:0006906	vesicle fusion	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0048209	regulation of vesicle targeting, to, from or within Golgi	IBA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006891	intra-Golgi vesicle-mediated transport	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray