• Gene id: 9525

Gene Summary

• Gene Symbol: VPS4B   Gene   UCSC   Ensembl
• Aliases: MIG1, SKD1, SKD1B, VPS4-2
• Gene name: vacuolar protein sorting 4 homolog B
• Alternate names: vacuolar protein sorting-associated protein 4B, cell migration-inducing 1, cell migration-inducing gene 1 protein, suppressor of K(+) transport growth defect 1, suppressor of K+ transport defect 1, vacuolar protein sorting 4B,
• Gene location: 18q21.33 (63422494: 63389189)     Exons: 12     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share
• OMIM: 609983

Protein Summary

• Protein general information: O75351  
  • Name: Vacuolar protein sorting associated protein 4B (EC 3.6.4.6) (Cell migration inducing gene 1 protein) (Suppressor of K(+) transport growth defect 1) (Protein SKD1)
  • Length: 444  
  • Mass: 49302
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEY
  LKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQLQGAIVIERPNVKWSDVAGLEGAKEALKEAV
  ILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGESEKLVKNLFQLARE
  NKPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPL
  PEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALMQPVRKVQSATHFKKVRGPSRADPNH
  LVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSNTKPTVNEHDLLKLKKFTEDFGQEG

• Structural information:
  • Protein Domains: (4..8-)
    (/note="MIT"-)
  • Interpro: IPR003593  IPR041569  IPR003959  IPR003960  IPR007330   IPR036181  IPR027417  IPR015415  
  • Prosite: PS00674
  • PDB: 1WR0 1XWI 2CPT 2JQH 2JQK 4U7Y
  • PDBsum: 1WR0 1XWI 2CPT 2JQH 2JQK 4U7Y
  • DIP: 53790
  • STRING: ENSP00000238497
• Other Databases: GeneCards:  VPS4B  Malacards:  VPS4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904903	ESCRT III complex disassembly	NAS	biological process
GO:0036258	multivesicular body assembly	NAS	biological process
GO:0016236	macroautophagy	NAS	biological process
GO:0016887	ATPase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0007033	vacuole organization	IBA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0016887	ATPase activity	IDA	molecular function
GO:0016197	endosomal transport	IDA	biological process
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0036258	multivesicular body assembly	IEA	biological process
GO:0061738	late endosomal microautophagy	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0007032	endosome organization	IEA	biological process
GO:0030301	cholesterol transport	IEA	biological process
GO:0048524	positive regulation of viral process	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0033993	response to lipid	IDA	biological process
GO:0010008	endosome membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0051261	protein depolymerization	IDA	biological process
GO:0090543	Flemming body	IDA	cellular component
GO:1904903	ESCRT III complex disassembly	IDA	biological process
GO:0042802	identical protein binding	IDA	molecular function
GO:0016887	ATPase activity	IDA	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:1902188	positive regulation of viral release from host cell	IMP	biological process
GO:1903543	positive regulation of exosomal secretion	IMP	biological process
GO:1903542	negative regulation of exosomal secretion	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0050792	regulation of viral process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090611	ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0039702	viral budding via host ESCRT complex	IGI	biological process
GO:0016887	ATPase activity	NAS	molecular function
GO:0032510	endosome to lysosome transport via multivesicular body sorting pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:1901673	regulation of mitotic spindle assembly	IMP	biological process
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0061952	midbody abscission	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019076	viral release from host cell	IMP	biological process
GO:0006997	nucleus organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903902	positive regulation of viral life cycle	IMP	biological process
GO:0048524	positive regulation of viral process	IMP	biological process
GO:1903724	positive regulation of centriole elongation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010824	regulation of centrosome duplication	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04217	Necroptosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881