• Gene id: 9522

Gene Summary

• Gene Symbol: SCAMP1   Gene   UCSC   Ensembl
• Aliases: SCAMP, SCAMP37
• Gene name: secretory carrier membrane protein 1
• Alternate names: secretory carrier-associated membrane protein 1,
• Gene location: 5q14.1 (78360529: 78480738)     Exons: 16     NC_000005.10
• Gene summary(Entrez): This gene product belongs to the SCAMP family of proteins, which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct gene
• OMIM: 606911

Protein Summary

• Protein general information: O15126  
  • Name: Secretory carrier associated membrane protein 1 (Secretory carrier membrane protein 1)
  • Length: 338  
  • Mass: 37920
  • Tissue specificity: Widely expressed, with highest expression in brain.
• Sequence:

  MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQ
  IAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVK
  LMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVY
  ICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQ
  QEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI

• Structural information:
  • Interpro: IPR007273  
  • STRING: ENSP00000481022
• Other Databases: GeneCards:  SCAMP1  Malacards:  SCAMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030136	clathrin-coated vesicle	ISS	cellular component
GO:0055038	recycling endosome membrane	IBA	cellular component
GO:0032588	trans-Golgi network membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0000139	Golgi membrane	IBA	cellular component
GO:0015031	protein transport	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006892	post-Golgi vesicle-mediated transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0042589	zymogen granule membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0015031	protein transport	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq