• Gene id: 9521

Gene Summary

• Gene Symbol: EEF1E1   Gene   UCSC   Ensembl
• Aliases: AIMP3, P18
• Gene name: eukaryotic translation elongation factor 1 epsilon 1
• Alternate names: eukaryotic translation elongation factor 1 epsilon-1, ARS-interacting multifunctional protein 3, aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, multisynthase complex auxiliary component p18, p18 component of aminoacyl-tRNA synthetase,
• Gene location: 6p24.3 (8102547: 8073359)     Exons: 5     NC_000006.12
• Gene summary(Entrez): This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown
• OMIM: 609206

Protein Summary

• Protein general information: O43324  
  • Name: Eukaryotic translation elongation factor 1 epsilon 1 (Aminoacyl tRNA synthetase complex interacting multifunctional protein 3) (Elongation factor p18) (Multisynthase complex auxiliary component p18)
  • Length: 174  
  • Mass: 19811
  • Tissue specificity: Down-regulated in various cancer tissues. {ECO
• Sequence:

  MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWL
  EYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQ
  HYPGIRQHLSSVVFIKNRLYTNSH

• Structural information:
  • Protein Domains: (50..17-)
    (/note="GST-C-terminal")
  • Interpro: IPR042450  IPR010987  IPR036282  IPR004046  
  • Prosite: PS50405
  • PDB: 2UZ8 4BL7 4BVX 4BVY 5BMU 5Y6L
  • PDBsum: 2UZ8 4BL7 4BVX 4BVY 5BMU 5Y6L
  • DIP: 50581
  • STRING: ENSP00000369038
• Other Databases: GeneCards:  EEF1E1  Malacards:  EEF1E1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IDA	cellular component
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IEA	cellular component
GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000774	positive regulation of cellular senescence	IDA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0043065	positive regulation of apoptotic process	ISS	biological process

Diseases

Associated diseases	References
Stomach cancer	PMID:21789020
urinary bladder cancer	PMID:24917520
colorectal cancer	PMID:21789020
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881