Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 9513
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol FXR2   Gene   UCSC   Ensembl
Aliases FMR1L2, FXR2P
Gene name FMR1 autosomal homolog 2
Alternate names fragile X mental retardation syndrome-related protein 2, fragile X mental retardation, autosomal homolog 2, fragile X-mental retardation 1-like 2,
Gene location 17p13.1 (7614896: 7591229)     Exons: 1     NC_000017.11
Gene summary(Entrez) The protein encoded by this gene is a RNA binding protein containing two KH domains and one RCG box, which is similar to FMRP and FXR1. It associates with polyribosomes, predominantly with 60S large ribosomal subunits. This encoded protein may self-associ
OMIM 605339

Protein Summary
Protein general information P51116  

Name: Fragile X mental retardation syndrome related protein 2

Length: 673  Mass: 74223

Sequence MGGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLPPPADYNKEITEGDEV
EVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLERLRPVNPNPLATKGSFFKVTMAVPEDLREA
CSNENVHKEFKKALGANCIFLNITNSELFILSTTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETSKQL
AAAFQEEFTVREDLMGLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSEDSVQVPR
NLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQALLEYHLSYLQEVEQLR
LERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYSTDESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPSSDVS
TASETESEKREEPNRAGPGDRDPPTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTS
EPEPPVDSEPGEPPPASARRRRSRRRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDG
SISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLPKGPSENGELSAPLELGSMVNGVS
Structural information
Protein Domains
 (14..6-)
(/note="Agenet-like-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00973-)
(73..12-)
(/note="Agenet-like-2)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00973-)
(232..26-)
(/note="KH-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PR-)
Interpro:  IPR008395  IPR040148  IPR040472  IPR022034  IPR032172  
IPR004087  IPR004088  IPR036612  IPR041560  
Prosite:   PS51641 PS50084

PDB:  		 3H8Z
PDBsum:   3H8Z
MINT:  
STRING:   ENSP00000250113
Other Databases GeneCards:  FXR2  Malacards:  FXR2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005737 cytoplasm
 IDA cellular component
GO:0051489 regulation of filopodium
assembly
 IBA biological process
GO:0045727 positive regulation of tr
anslation
 IBA biological process
GO:0043488 regulation of mRNA stabil
ity
 IBA biological process
GO:0042803 protein homodimerization
activity
 IBA molecular function
GO:0036464 cytoplasmic ribonucleopro
tein granule
 IBA cellular component
GO:0030424 axon
 IBA cellular component
GO:0017148 negative regulation of tr
anslation
 IBA biological process
GO:0003729 mRNA binding
 IBA molecular function
GO:0000381 regulation of alternative
mRNA splicing, via splic
eosome
 IBA biological process
GO:2001022 positive regulation of re
sponse to DNA damage stim
ulus
 IBA biological process
GO:1902737 dendritic filopodium
 IBA cellular component
GO:0098793 presynapse
 IBA cellular component
GO:0045182 translation regulator act
ivity
 IBA molecular function
GO:0044326 dendritic spine neck
 IBA cellular component
GO:0043197 dendritic spine
 IBA cellular component
GO:0043025 neuronal cell body
 IBA cellular component
GO:0035770 ribonucleoprotein granule
 IBA cellular component
GO:0030426 growth cone
 IBA cellular component
GO:0014069 postsynaptic density
 IBA cellular component
GO:0005844 polysome
 IBA cellular component
GO:0005737 cytoplasm
 IBA cellular component
GO:0005634 nucleus
 IBA cellular component
GO:0003730 mRNA 3'-UTR binding
 IBA molecular function
GO:0001934 positive regulation of pr
otein phosphorylation
 IBA biological process
GO:0042803 protein homodimerization
activity
 IDA molecular function
GO:0046982 protein heterodimerizatio
n activity
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0003729 mRNA binding
 IEA molecular function
GO:0006417 regulation of translation
 IEA biological process
GO:0003676 nucleic acid binding
 IEA molecular function
GO:0003723 RNA binding
 IEA molecular function
GO:0003723 RNA binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0003723 RNA binding
 TAS molecular function
GO:0005737 cytoplasm
 TAS cellular component
GO:0022625 cytosolic large ribosomal
subunit
 TAS cellular component
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0016020 membrane
 HDA cellular component
GO:0003723 RNA binding
 HDA molecular function
GO:0003723 RNA binding
 HDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03013RNA transport

Diseases

Expand All | Collapse All
Associated diseases References
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract