• Gene id: 9512

Gene Summary

• Gene Symbol: PMPCB   Gene   UCSC   Ensembl
• Aliases: Beta-MPP, MPP11, MPPB, MPPP52, P-52
• Gene name: peptidase, mitochondrial processing subunit beta
• Alternate names: mitochondrial-processing peptidase subunit beta, mitochondrial processing peptidase beta subunit, peptidase (mitochondrial processing) beta, peptidase, mitochondrial processing beta subunit,
• Gene location: 7q22.1 (103297434: 103329901)     Exons: 14     NC_000007.14
• Gene summary(Entrez): This gene is a member of the peptidase M16 family and encodes a protein with a zinc-binding motif. This protein is located in the mitochondrial matrix and catalyzes the cleavage of the leader peptides of precursor proteins newly imported into the mitochon
• OMIM: 603131

Protein Summary

• Protein general information: O75439  
  • Name: Mitochondrial processing peptidase subunit beta (EC 3.4.24.64) (Beta MPP) (P 52)
  • Length: 489  
  • Mass: 54366
• Sequence:

  MAAAAARVVLSSAARRRLWGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVASEDSG
  LSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLELEIENMGAHLNAYTSREQTVYYAKAFSKDL
  PRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKD
  LVDYITTHYKGPRIVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAIAV
  EAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCESSTVA
  DMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETI
  REVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLRD

• Structural information:
  • Interpro: IPR011249  IPR037718  IPR011765  IPR001431  IPR007863  
  • Prosite: PS00143
  • STRING: ENSP00000249269
• Other Databases: GeneCards:  PMPCB  Malacards:  PMPCB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017087	mitochondrial processing peptidase complex	IBA	cellular component
GO:0006627	protein processing involved in protein targeting to mitochondrion	IBA	biological process
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0004175	endopeptidase activity	IBA	contributes to
GO:0006508	proteolysis	IEA	biological process
GO:0006627	protein processing involved in protein targeting to mitochondrion	IEA	biological process
GO:0017087	mitochondrial processing peptidase complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006851	mitochondrial calcium ion transmembrane transport	TAS	biological process
GO:0006627	protein processing involved in protein targeting to mitochondrion	IEA	biological process
GO:0004175	endopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006627	protein processing involved in protein targeting to mitochondrion	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0004222	metalloendopeptidase activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R