• Gene id: 9508

Gene Summary

• Gene Symbol: ADAMTS3   Gene   UCSC   Ensembl
• Aliases: ADAMTS-4, HKLLS3
• Gene name: ADAM metallopeptidase with thrombospondin type 1 motif 3
• Alternate names: A disintegrin and metalloproteinase with thrombospondin motifs 3, ADAM-TS 3, ADAM-TS3, ADAMTS-3, PC II-NP, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 3, procollagen II N-proteinase, procollagen II amino propeptide-,
• Gene location: 4q13.3 (72569220: 72280968)     Exons: 24     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri
• OMIM: 609381

Protein Summary

• Protein general information: O15072  
  • Name: A disintegrin and metalloproteinase with thrombospondin motifs 3 (ADAM TS 3) (ADAM TS3) (ADAMTS 3) (EC 3.4.24. ) (Procollagen II N proteinase) (PC II NP) (Procollagen II amino propeptide processing enzyme)
  • Length: 1205  
  • Mass: 135603
  • Tissue specificity: Found in cartilage and skin.
• Sequence:

  MVLLSLWLIAAALVEVRTSADGQAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSS
  NPEQLFFNITAFGKDFHLRLKPNTQLVAPGAVVEWHETSLVPGNITDPINNHQPGSATYRIRRTEPLQTNCAYVG
  DIVDIPGTSVAISNCDGLAGMIKSDNEEYFIEPLERGKQMEEEKGRIHVVYKRSAVEQAPIDMSKDFHYRESDLE
  GLDDLGTVYGNIHQQLNETMRRRRHAGENDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVH
  INVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWASQQQRSDLNHSEHHDHAIFLTRQDFGPAGMQGYAPVTGM
  CHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMGSVMAPLVQAAFHRYHWSRCSGQELKRYI
  HSYDCLLDDPFDHDWPKLPELPGINYSMDEQCRFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLD
  GTECAAGKWCYKGHCMWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPMPINGGQDCPGVNFEYQLC
  NTEECQKHFEDFRAQQCQQRNSHFEYQNTKHHWLPYEHPDPKKRCHLYCQSKETGDVAYMKQLVHDGTHCSYKDP
  YSICVRGECVKVGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFTRTPRKLGYLKMFDIPPGARHVLIQEDEASP
  HILAIKNQATGHYILNGKGEEAKSRTFIDLGVEWDYNIEDDIESLHTDGPLHDPVIVLIIPQENDTRSSLTYKYI
  IHEDSVPTINSNNVIQEELDTFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCN
  IQECTHPLWVAEEWEHCTKTCGSSGYQLRTVRCLQPLLDGTNRSVHSKYCMGDRPESRRPCNRVPCPAQWKTGPW
  SECSVTCGEGTEVRQVLCRAGDHCDGEKPESVRACQLPPCNDEPCLGDKSIFCQMEVLARYCSIPGYNKLCCESC
  SKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPD
  GANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIIDNRRPTRS
  STLER

• Structural information:
  • Protein Domains: (256..46-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (470..55-)
    (/note="Disintegrin-)
    (551..60-)
    1 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (845..90-)
    (/note="TSP-typ)
  • Interpro: IPR041645  IPR010294  IPR013273  IPR024079  IPR001590   IPR002870  IPR010909  IPR000884  IPR036383  
  • Prosite: PS50215 PS50900 PS50092
  • STRING: ENSP00000286657
• Other Databases: GeneCards:  ADAMTS3  Malacards:  ADAMTS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016485	protein processing	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0016485	protein processing	IDA	biological process
GO:0016485	protein processing	IDA	biological process
GO:0032964	collagen biosynthetic process	IDA	biological process
GO:0097435	supramolecular fiber organization	IC	biological process
GO:1900748	positive regulation of vascular endothelial growth factor signaling pathway	IDA	biological process
GO:0010573	vascular endothelial growth factor production	IDA	biological process
GO:0030199	collagen fibril organization	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	TAS	colocalizes with
GO:0005576	extracellular region	IEA	cellular component
GO:0030199	collagen fibril organization	NAS	biological process
GO:0008270	zinc ion binding	NAS	molecular function
GO:0030574	collagen catabolic process	NAS	biological process
GO:0004222	metalloendopeptidase activity	NAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031012	extracellular matrix	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R