• Gene id: 9506

Gene Summary

• Gene Symbol: PAGE4   Gene   UCSC   Ensembl
• Aliases: CT16.7, GAGE-9, GAGEC1, JM-27, JM27, PAGE-1, PAGE-4
• Gene name: PAGE family member 4
• Alternate names: P antigen family member 4, P antigen family, member 4 (prostate associated), g antigen family C member 1, prostate-associated gene protein 4,
• Gene location: Xp11.23 (49829259: 49834263)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reprod
• OMIM: 608126

Protein Summary

• Protein general information: O60829  
  • Name: P antigen family member 4 (PAGE 4) (G antigen family C member 1) (PAGE 1)
  • Length: 102  
  • Mass: 11153
  • Tissue specificity: Expressed at basal lvels in the adult normal prostate gland but is highly up-regulated in the fetal prostate and prostate cancer cells (PubMed
• Sequence:

  MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSER
  GDGSDVKEKTPPNPKHAKTKEAGDGQP

• Structural information:
  • Interpro: IPR031320  IPR008625  
  • STRING: ENSP00000218068
• Other Databases: GeneCards:  PAGE4  Malacards:  PAGE4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903427	negative regulation of reactive oxygen species biosynthetic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0042594	response to starvation	IDA	biological process
GO:1903202	negative regulation of oxidative stress-induced cell death	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006979	response to oxidative stress	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0032872	regulation of stress-activated MAPK cascade	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881