• Gene id: 9502

Gene Summary

• Gene Symbol: XAGE2   Gene   UCSC   Ensembl
• Aliases: CT12.2, GAGED3, XAGE-2, XAGE2B
• Gene name: X antigen family member 2
• Alternate names: X antigen family member 2, G antigen family D member 3, X antigen family, member 2B, cancer/testis antigen 12.2, cancer/testis antigen family 12, member 2,
• Gene location: Xp11.22 (52368995: 52375682)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdo
• OMIM: 137163

Protein Summary

• Protein general information: Q96GT9  
  • Name: X antigen family member 2 (XAGE 2) (Cancer/testis antigen 12.2) (CT12.2) (G antigen family D member 3)
  • Length: 111  
  • Mass: 12354
• Sequence:

  MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQ
  TKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV

• Structural information:
  • Interpro: IPR031320  IPR008625  
  • STRING: ENSP00000286049
• Other Databases: GeneCards:  XAGE2  Malacards:  XAGE2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881