• Gene id: 950

Gene Summary

• Gene Symbol: SCARB2   Gene   UCSC   Ensembl
• Aliases: AMRF, CD36L2, EPM4, HLGP85, LGP85, LIMP-2, LIMPII, SR-BII
• Gene name: scavenger receptor class B member 2
• Alternate names: lysosome membrane protein 2, 85 kDa lysosomal membrane sialoglycoprotein, 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II,
• Gene location: 4q21.1 (162790701: 162812817)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorgani
• OMIM: 602257

Protein Summary

• Protein general information: Q14108  
  • Name: Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36)
  • Length: 478  
  • Mass: 54290
• Sequence:

  MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEI
  LRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVH
  FLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNF
  TKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAE
  ILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGI
  ILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFG
  LVFTWLACKGQGSMDEGTADERAPLIRT

• Structural information:
  • Interpro: IPR002159  IPR005429  
  • PDB: 4F7B 4Q4B 4Q4F 4TVZ 4TW0 4TW2 5UPH 5XBM 6I2K
  • PDBsum: 4F7B 4Q4B 4Q4F 4TVZ 4TW0 4TW2 5UPH 5XBM 6I2K
  • STRING: ENSP00000264896
• Other Databases: GeneCards:  SCARB2  Malacards:  SCARB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0015917	aminophospholipid transport	IEA	biological process
GO:0030666	endocytic vesicle membrane	IEA	cellular component
GO:0031210	phosphatidylcholine binding	IEA	molecular function
GO:0038024	cargo receptor activity	IEA	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0043471	regulation of cellular carbohydrate catabolic process	IEA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006622	protein targeting to lysosome	IEA	biological process
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0015485	cholesterol binding	IEA	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0051087	chaperone binding	IEA	molecular function
GO:1905123	regulation of glucosylceramidase activity	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005765	lysosomal membrane	ISS	cellular component
GO:0006622	protein targeting to lysosome	IMP	biological process
GO:0043202	lysosomal lumen	ISS	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0001786	phosphatidylserine binding	ISS	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005044	scavenger receptor activity	ISS	molecular function
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0031210	phosphatidylcholine binding	ISS	molecular function
GO:0015485	cholesterol binding	ISS	molecular function
GO:0038024	cargo receptor activity	IMP	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0006622	protein targeting to lysosome	NAS	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0043471	regulation of cellular carbohydrate catabolic process	IMP	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	ISS	cellular component
GO:0015917	aminophospholipid transport	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:1904978	regulation of endosome organization	TAS	biological process
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0031902	late endosome membrane	TAS	cellular component
GO:1905671	regulation of lysosome organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Progressive myoclonic epilepsy	KEGG:H00810
Progressive myoclonic epilepsy	KEGG:H00810
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881