• Gene id: 9495

Gene Summary

• Gene Symbol: AKAP5   Gene   UCSC   Ensembl
• Aliases: AKAP75, AKAP79, H21
• Gene name: A-kinase anchoring protein 5
• Alternate names: A-kinase anchor protein 5, A kinase (PRKA) anchor protein 5, A-kinase anchor protein 79 kDa, A-kinase anchoring protein 75/79, AKAP 79, cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein,
• Gene location: 14q23.3 (64465498: 64474502)     Exons: 2     NC_000014.9
• Gene summary(Entrez): The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene
• OMIM: 118470

Protein Summary

• Protein general information: P24588  
  • Name: A kinase anchor protein 5 (AKAP 5) (A kinase anchor protein 79 kDa) (AKAP 79) (H21) (cAMP dependent protein kinase regulatory subunit II high affinity binding protein)
  • Length: 427  
  • Mass: 47088
  • Tissue specificity: Predominantly in the cerebral cortex and the postsynaptic densities of the forebrain, and to a lesser extent in adrenal medulla, lung and anterior pituitary.
• Sequence:

  METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQEAGASDQPEPT
  RGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSNHSKIIEDSDC
  SIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQT
  GTLILEEIETIKEKQDVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIV
  AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFA
  NDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ

• Structural information:
  • Interpro: IPR042375  IPR001573  
  • Prosite: PS51893
  • PDB: 2H9R 3LL8 5NIN
  • PDBsum: 2H9R 3LL8 5NIN
  • DIP: 186
  • STRING: ENSP00000378207
• Other Databases: GeneCards:  AKAP5  Malacards:  AKAP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0030346	protein phosphatase 2B binding	IDA	molecular function
GO:0035254	glutamate receptor binding	IDA	molecular function
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0050811	GABA receptor binding	IBA	molecular function
GO:0045762	positive regulation of adenylate cyclase activity	IBA	biological process
GO:0035254	glutamate receptor binding	IBA	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IBA	molecular function
GO:0060090	molecular adaptor activity	IBA	molecular function
GO:0060076	excitatory synapse	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0032590	dendrite membrane	IBA	cellular component
GO:0031698	beta-2 adrenergic receptor binding	IBA	molecular function
GO:0014069	postsynaptic density	IBA	cellular component
GO:0008179	adenylate cyclase binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0098837	postsynaptic recycling endosome	IDA	cellular component
GO:0045121	membrane raft	IMP	cellular component
GO:1905751	positive regulation of endosome to plasma membrane protein transport	IMP	biological process
GO:0007194	negative regulation of adenylate cyclase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1900273	positive regulation of long-term synaptic potentiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007194	negative regulation of adenylate cyclase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006605	protein targeting	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0045762	positive regulation of adenylate cyclase activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008179	adenylate cyclase binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0051018	protein kinase A binding	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0034237	protein kinase A regulatory subunit binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:0008179	adenylate cyclase binding	IPI	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IMP	biological process
GO:0010738	regulation of protein kinase A signaling	IMP	biological process
GO:0008179	adenylate cyclase binding	IPI	molecular function

Diseases

Associated diseases	References
Alzheimer's disease	PMID:10460255
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R