• Gene id: 949

Gene Summary

• Gene Symbol: SCARB1   Gene   UCSC   Ensembl
• Aliases: CD36L1, CLA-1, CLA1, HDLQTL6, SR-BI, SRB1
• Gene name: scavenger receptor class B member 1
• Alternate names: scavenger receptor class B member 1, CD36 and LIMPII analogous 1, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1, scavenger receptor class B type III,
• Gene location: 12q24.31 (124863863: 124776855)     Exons: 15     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2
• OMIM: 601040

Protein Summary

• Protein general information: Q8WTV0  
  • Name: Scavenger receptor class B member 1 (SRB1) (CD36 and LIMPII analogous 1) (CLA 1) (CD36 antigen like 1) (Collagen type I receptor, thrombospondin receptor like 1) (SR BI) (CD antigen CD36)
  • Length: 552  
  • Mass: 60878
  • Tissue specificity: Widely expressed.
• Sequence:

  MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNP
  SEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMEN
  KPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGV
  QNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
  FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIH
  PVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLA
  LGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTL
  ASFACRVATTLPVLEGLGPSLGGGTGS

• Structural information:
  • Interpro: IPR005428  IPR002159  
  • STRING: ENSP00000261693
• Other Databases: GeneCards:  SCARB1  Malacards:  SCARB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0070508	cholesterol import	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005215	transporter activity	TAS	molecular function
GO:0070506	high-density lipoprotein particle receptor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035461	vitamin transmembrane transport	IMP	biological process
GO:0070508	cholesterol import	IMP	biological process
GO:0033344	cholesterol efflux	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0034384	high-density lipoprotein particle clearance	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070508	cholesterol import	IEA	biological process
GO:0070328	triglyceride homeostasis	IEA	biological process
GO:0043691	reverse cholesterol transport	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0034375	high-density lipoprotein particle remodeling	IEA	biological process
GO:0034185	apolipoprotein binding	IEA	molecular function
GO:0033344	cholesterol efflux	IEA	biological process
GO:0030301	cholesterol transport	IEA	biological process
GO:0010899	regulation of phosphatidylcholine catabolic process	IEA	biological process
GO:0005901	caveola	IEA	cellular component
GO:0006910	phagocytosis, recognition	IEA	biological process
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0050892	intestinal absorption	IEA	biological process
GO:0043534	blood vessel endothelial cell migration	IEA	biological process
GO:0034383	low-density lipoprotein particle clearance	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015914	phospholipid transport	IEA	biological process
GO:0010867	positive regulation of triglyceride biosynthetic process	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0008035	high-density lipoprotein particle binding	IEA	molecular function
GO:0006707	cholesterol catabolic process	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001935	endothelial cell proliferation	IEA	biological process
GO:0001540	amyloid-beta binding	IEA	molecular function
GO:0050764	regulation of phagocytosis	IEA	biological process
GO:0043654	recognition of apoptotic cell	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0031528	microvillus membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0006702	androgen biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0001786	phosphatidylserine binding	ISS	molecular function
GO:0034185	apolipoprotein binding	IPI	molecular function
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0001875	lipopolysaccharide immune receptor activity	IDA	molecular function
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0070506	high-density lipoprotein particle receptor activity	IDA	molecular function
GO:0005545	1-phosphatidylinositol binding	TAS	molecular function
GO:0034186	apolipoprotein A-I binding	IPI	molecular function
GO:0034186	apolipoprotein A-I binding	IPI	molecular function
GO:0015920	lipopolysaccharide transport	IDA	biological process
GO:0032497	detection of lipopolysaccharide	IDA	biological process
GO:0034384	high-density lipoprotein particle clearance	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0010886	positive regulation of cholesterol storage	IDA	biological process
GO:0043654	recognition of apoptotic cell	IDA	biological process
GO:0050764	regulation of phagocytosis	IC	biological process
GO:0051000	positive regulation of nitric-oxide synthase activity	IDA	biological process
GO:0005901	caveola	TAS	cellular component
GO:0010595	positive regulation of endothelial cell migration	TAS	biological process
GO:0010899	regulation of phosphatidylcholine catabolic process	ISS	biological process
GO:0033344	cholesterol efflux	ISS	biological process
GO:0034375	high-density lipoprotein particle remodeling	ISS	biological process
GO:0042060	wound healing	TAS	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0043691	reverse cholesterol transport	IEP	biological process
GO:0070328	triglyceride homeostasis	ISS	biological process
GO:0070508	cholesterol import	ISS	biological process
GO:0070508	cholesterol import	ISS	biological process
GO:0010867	positive regulation of triglyceride biosynthetic process	ISS	biological process
GO:0015914	phospholipid transport	ISS	biological process
GO:0034383	low-density lipoprotein particle clearance	ISS	biological process
GO:0044406	adhesion of symbiont to host	IMP	biological process
GO:0005901	caveola	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04934	Cushing syndrome
hsa04145	Phagosome
hsa05160	Hepatitis C
hsa04925	Aldosterone synthesis and secretion
hsa04976	Bile secretion
hsa04927	Cortisol synthesis and secretion
hsa04979	Cholesterol metabolism
hsa04975	Fat digestion and absorption
hsa04913	Ovarian steroidogenesis
hsa04977	Vitamin digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospadias	MIK: 22906644
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
22906644	Hypospadias	Methylation site (cg23556238)		20 (12 patients with isolated hypospadias and 8 healthy controls)	Male infertility	Microarray