• Gene id: 9486

Gene Summary

• Gene Symbol: CHST10   Gene   UCSC   Ensembl
• Aliases: HNK-1ST, HNK1ST
• Gene name: carbohydrate sulfotransferase 10
• Alternate names: carbohydrate sulfotransferase 10, HNK-1 sulfotransferase, huHNK-1ST,
• Gene location: 2q11.2 (100417667: 100391859)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glyc
• OMIM: 612190

Protein Summary

• Protein general information: O43529  
  • Name: Carbohydrate sulfotransferase 10 (EC 2.8.2. ) (HNK 1 sulfotransferase) (HNK 1ST) (HNK1ST) (HuHNK 1ST)
  • Length: 356  
  • Mass: 42207
  • Tissue specificity: In fetal tissues, it is predominantly expressed in brain, and weakly expressed in lung, kidney and liver. In adult, it is highly expressed in brain, testis, ovary, expressed at intermediate level in heart, pancreas, skeletal muscle, sp
• Sequence:

  MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQL
  VQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEE
  IPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKY
  RRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGID
  HLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN

• Structural information:
  • Interpro: IPR018011  IPR005331  
  • STRING: ENSP00000264249
• Other Databases: GeneCards:  CHST10  Malacards:  CHST10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0030166	proteoglycan biosynthetic process	IBA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016051	carbohydrate biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0016232	HNK-1 sulfotransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00515	Mannose type O-glycan biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881