• Gene id: 948

Gene Summary

• Gene Symbol: CD36   Gene   UCSC   Ensembl
• Aliases: BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3
• Gene name: CD36 molecule
• Alternate names: platelet glycoprotein 4, CD36 antigen (collagen type I receptor, thrombospondin receptor), CD36 molecule (thrombospondin receptor), GPIIIB, PAS IV, PAS-4 protein, cluster determinant 36, fatty acid translocase, glycoprotein IIIb, leukocyte differentiation antigen ,
• Gene location: 7q21.11 (80602206: 80679276)     Exons: 19     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhes
• OMIM: 602757

SNPs

rs1877031

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.39657827G>A
NC_000017.10   g.37814080G>A
NM_006804.4   c.350G>A
NM_006804.3   c.350G>A
XM_017024041.2   c.350G>A
NM_001165937.1   c.350G>A
XM_024450549.1   c.-418G>A
NM_001165938.1   c.350G>A
NP_006795.3   p.Arg117Gln
XP_016879530.1   p.Arg117Gln
NP_001  

Protein Summary

• Protein general information: P16671  
  • Name: Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS 4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
  • Length: 472  
  • Mass: 53053
• Sequence:

  MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQE
  VMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQ
  NQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVA
  IIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
  ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEP
  ITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLS
  VGVVMFVAFMISYCACRSKTIK

• Structural information:
  • Interpro: IPR005428  IPR033076  IPR002159  
  • PDB: 5LGD
  • PDBsum: 5LGD
  • STRING: ENSP00000399421
• Other Databases: GeneCards:  CD36  Malacards:  CD36

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	IC	molecular function
GO:0001540	amyloid-beta binding	IDA	molecular function
GO:0071944	cell periphery	IDA	cellular component
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:0150025	oxidised low-density lipoprotein particle receptor activity	IMP	molecular function
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0005044	scavenger receptor activity	IMP	molecular function
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0005324	long-chain fatty acid transporter activity	IMP	molecular function
GO:0015636	short-chain fatty acid transmembrane transporter activity	IMP	molecular function
GO:0035325	Toll-like receptor binding	IPI	molecular function
GO:1904646	cellular response to amyloid-beta	IGI	biological process
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0002532	production of molecular mediator involved in inflammatory response	TAS	biological process
GO:1990379	lipid transport across blood-brain barrier	IMP	biological process
GO:0150024	oxidised low-density lipoprotein particle clearance	IMP	biological process
GO:0098900	regulation of action potential	ISS	biological process
GO:0006631	fatty acid metabolic process	TAS	biological process
GO:0006911	phagocytosis, engulfment	TAS	biological process
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0043254	regulation of protein-containing complex assembly	IMP	biological process
GO:0005623	obsolete cell	IPI	cellular component
GO:0140052	cellular response to oxidised low-density lipoprotein particle stimulus	IMP	biological process
GO:1903428	positive regulation of reactive oxygen species biosynthetic process	ISS	biological process
GO:0043235	receptor complex	IPI	cellular component
GO:0150094	amyloid-beta clearance by cellular catabolic process	IMP	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0009986	cell surface	TAS	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IGI	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IGI	biological process
GO:0010942	positive regulation of cell death	IMP	biological process
GO:0015909	long-chain fatty acid transport	IMP	biological process
GO:0031664	regulation of lipopolysaccharide-mediated signaling pathway	TAS	biological process
GO:0015912	short-chain fatty acid transport	IMP	biological process
GO:0034121	regulation of toll-like receptor signaling pathway	IGI	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:1990000	amyloid fibril formation	ISS	biological process
GO:0050702	interleukin-1 beta secretion	ISS	biological process
GO:0070543	response to linoleic acid	ISS	biological process
GO:0050909	sensory perception of taste	ISS	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	ISS	biological process
GO:0070508	cholesterol import	ISS	biological process
GO:0034197	triglyceride transport	ISS	biological process
GO:0030299	intestinal cholesterol absorption	ISS	biological process
GO:0033993	response to lipid	ISS	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	ISS	biological process
GO:0031623	receptor internalization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050892	intestinal absorption	ISS	biological process
GO:0031526	brush border membrane	ISS	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0097009	energy homeostasis	ISS	biological process
GO:0097009	energy homeostasis	ISS	biological process
GO:0070542	response to fatty acid	ISS	biological process
GO:0070542	response to fatty acid	ISS	biological process
GO:0006955	immune response	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006629	lipid metabolic process	NAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0045335	phagocytic vesicle	TAS	cellular component
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0031092	platelet alpha granule membrane	TAS	cellular component
GO:0038124	toll-like receptor TLR6:TLR2 signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006910	phagocytosis, recognition	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	IEA	biological process
GO:0030299	intestinal cholesterol absorption	IEA	biological process
GO:0030301	cholesterol transport	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0033993	response to lipid	IEA	biological process
GO:0034197	triglyceride transport	IEA	biological process
GO:0042308	negative regulation of protein import into nucleus	IEA	biological process
GO:0042953	lipoprotein transport	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0044539	long-chain fatty acid import into cell	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045177	apical part of cell	IEA	cellular component
GO:0050702	interleukin-1 beta secretion	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0070508	cholesterol import	IEA	biological process
GO:0070543	response to linoleic acid	IEA	biological process
GO:0070892	lipoteichoic acid immune receptor activity	IEA	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	IEA	biological process
GO:0071447	cellular response to hydroperoxide	IEA	biological process
GO:0098900	regulation of action potential	IEA	biological process
GO:1990000	amyloid fibril formation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005041	low-density lipoprotein particle receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0010886	positive regulation of cholesterol storage	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0019915	lipid storage	IEA	biological process
GO:0030169	low-density lipoprotein particle binding	IEA	molecular function
GO:0030194	positive regulation of blood coagulation	IEA	biological process
GO:0031526	brush border membrane	IEA	cellular component
GO:0031623	receptor internalization	IEA	biological process
GO:0032735	positive regulation of interleukin-12 production	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0034381	plasma lipoprotein particle clearance	IEA	biological process
GO:0034383	low-density lipoprotein particle clearance	IEA	biological process
GO:0035634	response to stilbenoid	IEA	biological process
GO:0043277	apoptotic cell clearance	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0050892	intestinal absorption	IEA	biological process
GO:0055096	low-density lipoprotein particle mediated signaling	IEA	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	IEA	biological process
GO:0060907	positive regulation of macrophage cytokine production	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070542	response to fatty acid	IEA	biological process
GO:0071221	cellular response to bacterial lipopeptide	IEA	biological process
GO:0071223	cellular response to lipoteichoic acid	IEA	biological process
GO:0097009	energy homeostasis	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	IEA	biological process
GO:1903428	positive regulation of reactive oxygen species biosynthetic process	IEA	biological process
GO:2000121	regulation of removal of superoxide radicals	IEA	biological process
GO:2000334	positive regulation of blood microparticle formation	IEA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0050431	transforming growth factor beta binding	ISS	molecular function
GO:0070053	thrombospondin receptor activity	ISS	molecular function
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0005041	low-density lipoprotein particle receptor activity	TAS	molecular function
GO:0005041	low-density lipoprotein particle receptor activity	IMP	molecular function
GO:0001954	positive regulation of cell-matrix adhesion	IDA	biological process
GO:0044539	long-chain fatty acid import into cell	IDA	biological process
GO:0019934	cGMP-mediated signaling	IDA	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	IMP	biological process
GO:0030301	cholesterol transport	ISS	biological process
GO:0042953	lipoprotein transport	TAS	biological process
GO:0042953	lipoprotein transport	IMP	biological process
GO:0007263	nitric oxide mediated signal transduction	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0019915	lipid storage	IMP	biological process
GO:0034381	plasma lipoprotein particle clearance	ISS	biological process
GO:0034383	low-density lipoprotein particle clearance	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0071813	lipoprotein particle binding	IDA	molecular function
GO:0044539	long-chain fatty acid import into cell	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04152	AMPK signaling pathway
hsa04931	Insulin resistance
hsa04512	ECM-receptor interaction
hsa04640	Hematopoietic cell lineage
hsa03320	PPAR signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa04979	Cholesterol metabolism
hsa04975	Fat digestion and absorption
hsa05144	Malaria

Diseases

Associated diseases	References
Coronary artery disease	KEGG:H01742
CD36 deficiency	KEGG:H01108
Coronary artery disease	KEGG:H01742
CD36 deficiency	KEGG:H01108
Rheumatic heart disease	PMID:16741676
Atrial fibrillation	PMID:21195211
Myeloid neoplasm	PMID:12479587
Alzheimer's disease	PMID:16563568
Thrombotic thrombocytopenic purpura	PMID:7529543
Sickle cell anemia	PMID:18322255
granulomatosis with polyangiitis	PMID:21412229
Hemolytic-uremic syndrome	PMID:16197457
blood platelet disease	PMID:11950861
Essential thrombocythemia	PMID:8555064
Arteriosclerosis	PMID:18723424
Multiple sclerosis	PMID:20855355
Endometriosis	PMID:19606481
Inclusion body myositis	PMID:17572512
Osteoarthritis	PMID:15334463
chronic myeloid leukemia	PMID:8555064
Polycythemia vera	PMID:8555064
Pemphigus	PMID:21255096
type 2 diabetes mellitus	PMID:16952981
type 2 diabetes mellitus	PMID:12479587
type 2 diabetes mellitus	PMID:20134099
type 2 diabetes mellitus	PMID:16911630
type 2 diabetes mellitus	PMID:15221799
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray