• Gene id: 9479

Gene Summary

• Gene Symbol: MAPK8IP1   Gene   UCSC   Ensembl
• Aliases: IB1, JIP-1, JIP1, PRKM8IP
• Gene name: mitogen-activated protein kinase 8 interacting protein 1
• Alternate names: C-Jun-amino-terminal kinase-interacting protein 1, IB-1, JNK MAP kinase scaffold protein 1, JNK-interacting protein 1, PRKM8 interacting protein, islet-brain 1,
• Gene location: 11p11.2 (45885650: 45906464)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a regulator of the pancreatic beta-cell function. It is highly similar to JIP-1, a mouse protein known to be a regulator of c-Jun amino-terminal kinase (Mapk8). This protein has been shown to prevent MAPK8 mediated activation of transcri
• OMIM: 604641

Protein Summary

• Protein general information: Q9UQF2  
  • Name: C Jun amino terminal kinase interacting protein 1 (JIP 1) (JNK interacting protein 1) (Islet brain 1) (IB 1) (JNK MAP kinase scaffold protein 1) (Mitogen activated protein kinase 8 interacting protein 1)
  • Length: 711  
  • Mass: 77524
  • Tissue specificity: Highly expressed in brain. Expressed in neurons, localizing to neurite tips in differentiating cells. Also expressed in the pancreas, testis and prostate. Low levels in heart, ovary and small intestine. Decreased levels in pancreatic b
• Sequence:

  MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGL
  LSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAARRPGAGPPKAESGQEPASRGQGQSQGQSQGP
  GSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAP
  TTDRGTSTDSPCRRSTATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFL
  PPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALS
  YDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVSSPYESAIGEEYEEAPRPQPPACLSEDSTPD
  EPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYW
  YEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLT
  VHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFV
  SEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE

• Structural information:
  • Protein Domains: (488..54-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (561..70-)
    (/note="PID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148"-)
  • Interpro: IPR035638  IPR011993  IPR006020  IPR036028  IPR001452  
  • Prosite: PS01179 PS50002
  • CDD: cd11943
  • PDB: 2G01 2GMX 2H96 3OXI 3PTG 3VUD 3VUG 3VUH 3VUI 3VUK 3VUL 3VUM 4E73 4G1W 4H39 4HYS 4HYU 4IZY 5LW1 6FUZ
  • PDBsum: 2G01 2GMX 2H96 3OXI 3PTG 3VUD 3VUG 3VUH 3VUI 3VUK 3VUL 3VUM 4E73 4G1W 4H39 4HYS 4HYU 4IZY 5LW1 6FUZ
  • STRING: ENSP00000241014
• Other Databases: GeneCards:  MAPK8IP1  Malacards:  MAPK8IP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045807	positive regulation of endocytosis	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0006898	receptor-mediated endocytosis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0043508	negative regulation of JUN kinase activity	ISS	biological process
GO:2000564	regulation of CD8-positive, alpha-beta T cell proliferation	ISS	biological process
GO:0046330	positive regulation of JNK cascade	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0004860	protein kinase inhibitor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005078	MAP-kinase scaffold activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043508	negative regulation of JUN kinase activity	IEA	biological process
GO:0044295	axonal growth cone	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0044302	dentate gyrus mossy fiber	IEA	cellular component
GO:0046328	regulation of JNK cascade	IEA	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008432	JUN kinase binding	IEA	molecular function
GO:0031434	mitogen-activated protein kinase kinase binding	IEA	molecular function
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IEA	molecular function
GO:0044294	dendritic growth cone	IEA	cellular component
GO:0046329	negative regulation of JNK cascade	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007258	JUN phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0019894	kinesin binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:2000564	regulation of CD8-positive, alpha-beta T cell proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0019894	kinesin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046328	regulation of JNK cascade	ISS	biological process
GO:0016192	vesicle-mediated transport	ISS	biological process
GO:0005078	MAP-kinase scaffold activity	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq