• Gene id: 9475

Gene Summary

• Gene Symbol: ROCK2   Gene   UCSC   Ensembl
• Aliases: ROCK-II
• Gene name: Rho associated coiled-coil containing protein kinase 2
• Alternate names: rho-associated protein kinase 2, p164 ROCK-2, rho-associated, coiled-coil-containing protein kinase II,
• Gene location: 2p25.1 (11345436: 11179758)     Exons: 37     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is a
• OMIM: 604002

Protein Summary

• Protein general information: O75116  
  • Name: Rho associated protein kinase 2 (EC 2.7.11.1) (Rho kinase 2) (Rho associated, coiled coil containing protein kinase 2) (Rho associated, coiled coil containing protein kinase II) (ROCK II) (p164 ROCK 2)
  • Length: 1388  
  • Mass: 160900
  • Tissue specificity: Expressed in the brain (at protein level). {ECO
• Sequence:

  MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRY
  EKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSP
  WVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKH
  GHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV
  GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPEL
  SSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLY
  TLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK
  KRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
  DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKILLAKVELEKRQLQER
  FTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKV
  ENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEK
  QLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
  KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETN
  RTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKR
  GNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQA
  LHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
  DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCE
  ACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPK
  KPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS

• Structural information:
  • Protein Domains: (92..35-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (357..42-)
    (/note="AGC-kinase-C-terminal)
    (497..57-)
    (/note="REM-1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (979..104-)
    (/note="RhoB-)
  • Interpro: IPR000961  IPR011009  IPR002219  IPR011993  IPR001849   IPR000719  IPR017441  IPR015008  IPR020684  IPR037311  IPR008271  
  • Prosite: PS51285 PS50003 PS00107 PS50011 PS00108 PS51860 PS51859 PS50081
  • CDD: cd00029 cd11638
  • PDB: 4L6Q 4WOT 5U7Q 5U7R 6ED6 6P5M 6P5P
  • PDBsum: 4L6Q 4WOT 5U7Q 5U7R 6ED6 6P5M 6P5P
  • STRING: ENSP00000317985
• Other Databases: GeneCards:  ROCK2  Malacards:  ROCK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072518	Rho-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0050321	tau-protein kinase activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0002931	response to ischemia	ISS	biological process
GO:1902993	positive regulation of amyloid precursor protein catabolic process	IMP	biological process
GO:1902993	positive regulation of amyloid precursor protein catabolic process	ISS	biological process
GO:0110061	regulation of angiotensin-activated signaling pathway	ISS	biological process
GO:1902966	positive regulation of protein localization to early endosome	IMP	biological process
GO:0097746	regulation of blood vessel diameter	ISS	biological process
GO:1990776	response to angiotensin	ISS	biological process
GO:1905205	positive regulation of connective tissue replacement	ISS	biological process
GO:1905205	positive regulation of connective tissue replacement	ISS	biological process
GO:1900037	regulation of cellular response to hypoxia	ISS	biological process
GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	IMP	biological process
GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	ISS	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	ISS	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	IMP	biological process
GO:0150033	negative regulation of protein localization to lysosome	IMP	biological process
GO:1902004	positive regulation of amyloid-beta formation	ISS	biological process
GO:1902004	positive regulation of amyloid-beta formation	IMP	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	ISS	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	ISS	biological process
GO:1905145	cellular response to acetylcholine	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0071559	response to transforming growth factor beta	ISS	biological process
GO:0071559	response to transforming growth factor beta	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0090271	positive regulation of fibroblast growth factor production	ISS	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0051246	regulation of protein metabolic process	ISS	biological process
GO:0061157	mRNA destabilization	ISS	biological process
GO:0032723	positive regulation of connective tissue growth factor production	ISS	biological process
GO:0031644	regulation of nervous system process	ISS	biological process
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0039694	viral RNA genome replication	IMP	biological process
GO:1901888	regulation of cell junction assembly	IBA	biological process
GO:0072518	Rho-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0048598	embryonic morphogenesis	IBA	biological process
GO:0031032	actomyosin structure organization	IBA	biological process
GO:0030866	cortical actin cytoskeleton organization	IBA	biological process
GO:0007266	Rho protein signal transduction	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0018107	peptidyl-threonine phosphorylation	IBA	biological process
GO:0017049	GTP-Rho binding	IBA	molecular function
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000281	mitotic cytokinesis	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:2000145	regulation of cell motility	TAS	biological process
GO:2000114	regulation of establishment of cell polarity	TAS	biological process
GO:0051492	regulation of stress fiber assembly	TAS	biological process
GO:0051298	centrosome duplication	IMP	biological process
GO:0045616	regulation of keratinocyte differentiation	IMP	biological process
GO:0030155	regulation of cell adhesion	TAS	biological process
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0006939	smooth muscle contraction	TAS	biological process
GO:0051893	regulation of focal adhesion assembly	TAS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0032956	regulation of actin cytoskeleton organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006939	smooth muscle contraction	IEA	biological process
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0017048	Rho GTPase binding	IEA	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0010825	positive regulation of centrosome duplication	IEA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005198	structural molecule activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0003180	aortic valve morphogenesis	ISS	biological process
GO:0070168	negative regulation of biomineral tissue development	ISS	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903140	regulation of establishment of endothelial barrier	IGI	biological process
GO:0072659	protein localization to plasma membrane	IGI	biological process
GO:0072518	Rho-dependent protein serine/threonine kinase activity	IMP	molecular function
GO:1903347	negative regulation of bicellular tight junction assembly	IGI	biological process
GO:0035509	negative regulation of myosin-light-chain-phosphatase activity	IMP	biological process
GO:0030866	cortical actin cytoskeleton organization	IGI	biological process
GO:1903140	regulation of establishment of endothelial barrier	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0030866	cortical actin cytoskeleton organization	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0071394	cellular response to testosterone stimulus	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0035509	negative regulation of myosin-light-chain-phosphatase activity	IGI	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05130	Pathogenic Escherichia coli infection
hsa04360	Axon guidance
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04530	Tight junction
hsa04921	Oxytocin signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04071	Sphingolipid signaling pathway
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)