• Gene id: 9474

Gene Summary

• Gene Symbol: ATG5   Gene   UCSC   Ensembl
• Aliases: APG5, APG5-LIKE, APG5L, ASP, SCAR25, hAPG5
• Gene name: autophagy related 5
• Alternate names: autophagy protein 5, APG5 autophagy 5-like, ATG5 autophagy related 5 homolog, apoptosis-specific protein,
• Gene location: 6q21 (106325819: 106184475)     Exons: 10     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle forma
• OMIM: 604261

Protein Summary

• Protein general information: Q9H1Y0  
  • Name: Autophagy protein 5 (APG5 like) (Apoptosis specific protein)
  • Length: 275  
  • Mass: 32447
  • Tissue specificity: Ubiquitous. The mRNA is present at similar levels in viable and apoptotic cells, whereas the protein is dramatically highly expressed in apoptotic cells.
• Sequence:

  MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGT
  PLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDH
  KQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPS
  AIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

• Structural information:
  • Interpro: IPR007239  IPR042526  IPR042527  
  • PDB: 4GDK 4GDL 4NAW 4TQ0 4TQ1 5D7G 5NPV 5NPW
  • PDBsum: 4GDK 4GDL 4NAW 4TQ0 4TQ1 5D7G 5NPV 5NPW
  • DIP: 29758
  • STRING: ENSP00000358072
• Other Databases: GeneCards:  ATG5  Malacards:  ATG5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035973	aggrephagy	IMP	biological process
GO:0000045	autophagosome assembly	IBA	biological process
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0006501	C-terminal protein lipidation	IBA	biological process
GO:0034045	phagophore assembly site membrane	IBA	cellular component
GO:0044804	autophagy of nucleus	IBA	biological process
GO:0006995	cellular response to nitrogen starvation	IBA	biological process
GO:0034274	Atg12-Atg5-Atg16 complex	IBA	cellular component
GO:1902017	regulation of cilium assembly	ISS	biological process
GO:0005930	axoneme	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006914	autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000619	negative regulation of histone H4-K16 acetylation	IEA	biological process
GO:1902017	regulation of cilium assembly	IEA	biological process
GO:0070257	positive regulation of mucus secretion	IEA	biological process
GO:0055015	ventricular cardiac muscle cell development	IEA	biological process
GO:0050765	negative regulation of phagocytosis	IEA	biological process
GO:0048840	otolith development	IEA	biological process
GO:0043687	post-translational protein modification	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0009620	response to fungus	IEA	biological process
GO:0005930	axoneme	IEA	cellular component
GO:0001974	blood vessel remodeling	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0071500	cellular response to nitrosative stress	IEA	biological process
GO:0061739	protein lipidation involved in autophagosome assembly	IEA	biological process
GO:0060047	heart contraction	IEA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0045060	negative thymic T cell selection	IEA	biological process
GO:0044233	mitochondria-associated endoplasmic reticulum membrane	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0042311	vasodilation	IEA	biological process
GO:0039689	negative stranded viral RNA replication	IEA	biological process
GO:0035973	aggrephagy	IEA	biological process
GO:0034045	phagophore assembly site membrane	IEA	cellular component
GO:0019883	antigen processing and presentation of endogenous antigen	IEA	biological process
GO:0016236	macroautophagy	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0002739	regulation of cytokine production involved in immune response	IEA	biological process
GO:0000422	autophagy of mitochondrion	IEA	biological process
GO:0000045	autophagosome assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0034045	phagophore assembly site membrane	IEA	cellular component
GO:0006914	autophagy	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	ISS	biological process
GO:0043687	post-translational protein modification	ISS	biological process
GO:0034045	phagophore assembly site membrane	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0075044	positive regulation by symbiont of host autophagy	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04621	NOD-like receptor signaling pathway
hsa04140	Autophagy - animal
hsa04211	Longevity regulating pathway
hsa04137	Mitophagy - animal
hsa04622	RIG-I-like receptor signaling pathway
hsa04213	Longevity regulating pathway - multiple species
hsa04216	Ferroptosis
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq