About Us

Search Result


Gene id 9470
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol EIF4E2   Gene   UCSC   Ensembl
Aliases 4E-LP, 4EHP, EIF4EL3, IF4e, h4EHP
Gene name eukaryotic translation initiation factor 4E family member 2
Alternate names eukaryotic translation initiation factor 4E type 2, eIF-4E type 2, eIF4E-like cap-binding protein, eIF4E-like protein 4E-LP, eukaryotic translation initiation factor 4E homologous protein, eukaryotic translation initiation factor 4E-like 3, mRNA cap-binding pro,
Gene location 2q37.1 (232550586: 232583644)     Exons: 15     NC_000002.12
OMIM 605895

Protein Summary

Protein general information O60573  

Name: Eukaryotic translation initiation factor 4E type 2 (eIF 4E type 2) (eIF4E type 2) (Eukaryotic translation initiation factor 4E homologous protein) (Eukaryotic translation initiation factor 4E like 3) (eIF4E like protein 4E LP) (mRNA cap binding protein 4E

Length: 245  Mass: 28362

Sequence MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSS
QSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWEN
LILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPG
RLGPQRLLFQNLWKPRLNVP
Structural information
Interpro:  IPR023398  IPR001040  IPR019770  
Prosite:   PS00813

PDB:  
2JGB 2JGC 5NVK 5NVL 5NVM 5NVN 5XLN
PDBsum:   2JGB 2JGC 5NVK 5NVL 5NVM 5NVN 5XLN

DIP:  

32578

MINT:  
STRING:   ENSP00000258416
Other Databases GeneCards:  EIF4E2  Malacards:  EIF4E2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003743 translation initiation fa
ctor activity
IBA molecular function
GO:0000340 RNA 7-methylguanosine cap
binding
IBA molecular function
GO:0016281 eukaryotic translation in
itiation factor 4F comple
x
IBA cellular component
GO:0005845 mRNA cap binding complex
IDA cellular component
GO:0031625 ubiquitin protein ligase
binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0003723 RNA binding
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0006413 translational initiation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006412 translation
IEA biological process
GO:0006417 regulation of translation
IEA biological process
GO:0003723 RNA binding
IEA molecular function
GO:0006413 translational initiation
IEA biological process
GO:0008135 translation factor activi
ty, RNA binding
TAS molecular function
GO:0000339 RNA cap binding
TAS molecular function
GO:0017148 negative regulation of tr
anslation
IMP biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0001701 in utero embryonic develo
pment
IEA biological process
GO:0003723 RNA binding
HDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa03013RNA transport
hsa04150mTOR signaling pathway
hsa04910Insulin signaling pathway
hsa04066HIF-1 signaling pathway
hsa04211Longevity regulating pathway
hsa01521EGFR tyrosine kinase inhibitor resistance
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract