• Gene id: 9469

Gene Summary

• Gene Symbol: CHST3   Gene   UCSC   Ensembl
• Aliases: C6ST, C6ST1, HSD
• Gene name: carbohydrate sulfotransferase 3
• Alternate names: carbohydrate sulfotransferase 3, C6ST-1, GST-0, carbohydrate (chondroitin 6) sulfotransferase 3, chondroitin 6 sulfotransferase 1, chondroitin 6-O-sulfotransferase 1, galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0,
• Gene location: 10q22.1 (71964394: 72013561)     Exons: 5     NC_000010.11
• Gene summary(Entrez): This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal
• OMIM: 605631

Protein Summary

• Protein general information: Q7LGC8  
  • Name: Carbohydrate sulfotransferase 3 (EC 2.8.2.17) (Chondroitin 6 O sulfotransferase 1) (C6ST 1) (Chondroitin 6 sulfotransferase) (Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 0) (GST 0)
  • Length: 479  
  • Mass: 54706
  • Tissue specificity: Widely expressed in adult tissues. Expressed in heart, placenta, skeletal muscle and pancreas. Also expressed in various immune tissues such as spleen, lymph node, thymus and appendix. {ECO
• Sequence:

  MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALADANSTDPALILAENA
  SLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGE
  FFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSS
  RSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLV
  RDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVA
  RGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRL
  FGYKLARDAAALTNRSVSLLEERGTFWVT

• Structural information:
  • Interpro: IPR016469  IPR027417  IPR000863  
  • STRING: ENSP00000362207
• Other Databases: GeneCards:  CHST3  Malacards:  CHST3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008459	chondroitin 6-sulfotransferase activity	IBA	molecular function
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0030206	chondroitin sulfate biosynthetic process	IBA	biological process
GO:0006790	sulfur compound metabolic process	IBA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IBA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008459	chondroitin 6-sulfotransferase activity	IEA	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030206	chondroitin sulfate biosynthetic process	IDA	biological process
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0008459	chondroitin 6-sulfotransferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa00532	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Diseases

Associated diseases	References
Spondyloepiphyseal dysplasia with congenital joint dislocations	KEGG:H00762
Spondyloepiphyseal dysplasia with congenital joint dislocations	KEGG:H00762
Osteochondrodysplasia	PMID:15215498
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq