• Gene id: 9466

Gene Summary

• Gene Symbol: IL27RA   Gene   UCSC   Ensembl
• Aliases: CRL1, IL-27RA, IL27R, TCCR, WSX1, zcytor1
• Gene name: interleukin 27 receptor subunit alpha
• Alternate names: interleukin-27 receptor subunit alpha, IL-27 receptor subunit alpha, IL-27R subunit alpha, IL-27R-alpha, T-cell cytokine receptor type 1, class I cytokine receptor, cytokine receptor WSX-1, cytokine receptor-like 1, interleukin 27 receptor, alpha, type I T-cell cy,
• Gene location: 19p13.12 (14031761: 14053217)     Exons: 14     NC_000019.10
• Gene summary(Entrez): In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most a
• OMIM: 607110

Protein Summary

• Protein general information: Q6UWB1  
  • Name: Interleukin 27 receptor subunit alpha (IL 27 receptor subunit alpha) (IL 27R subunit alpha) (IL 27R alpha) (IL 27RA) (Cytokine receptor WSX 1) (Cytokine receptor like 1) (Type I T cell cytokine receptor) (TCCR) (ZcytoR1)
  • Length: 636  
  • Mass: 69474
  • Tissue specificity: Highly expressed in lymphoid tissues such as spleen, lymph nodes and peripheral blood leukocytes. Weakly expressed in other tissues examined including heart, brain, fetal and adult lung, liver, skeletal muscle, kidney, pancreas, prosta
• Sequence:

  MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRS
  NKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVH
  WAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILS
  FQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGITCCCSLIPSGAEWARVSA
  VNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLEHVVDWARDGDPLEKLNWVRLPPGNL
  SALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGPTLWRLQDAPPGTPAIAWGEVPRHQLRGHLT
  HYTLCAQSGTSPSVCMNVSGNTQSVTLPDLPWGPCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLW
  GLFLLGCGLSLATSGRCYHLRHKVLPRWVWEKVPDPANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESS
  QPAQATAPLDSGYEKHFLPTPEELGLLGPPRPQVLA

• Structural information:
  • Protein Domains: (131..23-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (322..41-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (419..51-)
    3 (/note="Fibronectin-type-III)
    (/e-)
  • Interpro: IPR003961  IPR036116  IPR013783  
  • Prosite: PS50853
  • CDD: cd00063
  • STRING: ENSP00000263379
• Other Databases: GeneCards:  IL27RA  Malacards:  IL27RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0045509	interleukin-27 receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070106	interleukin-27-mediated signaling pathway	TAS	biological process
GO:0070757	interleukin-35-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900165	negative regulation of interleukin-6 secretion	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0002829	negative regulation of type 2 immune response	IEA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	IEA	biological process
GO:2000408	negative regulation of T cell extravasation	IEA	biological process
GO:2000317	negative regulation of T-helper 17 type immune response	IEA	biological process
GO:1905077	negative regulation of interleukin-17 secretion	IEA	biological process
GO:1904468	negative regulation of tumor necrosis factor secretion	IEA	biological process
GO:0048302	regulation of isotype switching to IgG isotypes	IEA	biological process
GO:0045509	interleukin-27 receptor activity	IEA	molecular function
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0002692	negative regulation of cellular extravasation	IEA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04659	Th17 cell differentiation

Diseases

Associated diseases	References
systemic scleroderma	PMID:20705635
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq