• Gene id: 9465

Gene Summary

• Gene Symbol: AKAP7   Gene   UCSC   Ensembl
• Aliases: AKAP15, AKAP18
• Gene name: A-kinase anchoring protein 7
• Alternate names: A-kinase anchoring protein 7, A kinase (PRKA) anchor protein 7, A-kinase anchor protein 18 kDa, A-kinase anchor protein 9 kDa, AKAP 18,
• Gene location: 6q23.2 (51505619: 51394260)     Exons: 31     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartment
• OMIM: 604693

Protein Summary

• Protein general information: O43687  
  • Name: A kinase anchor protein 7 isoforms alpha and beta (AKAP 7 isoforms alpha and beta) (A kinase anchor protein 18 kDa) (AKAP 18) (Protein kinase A anchoring protein 7 isoforms alpha/beta) (PRKA7 isoforms alpha/beta)
  • Length: 104  
  • Mass: 11465
  • Tissue specificity: Expressed in brain, heart, lung, pancreas and skeletal muscle. {ECO
• Sequence:

  MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEET
  QNKNKPGEGSSVKTEAADQNGNDNENNRK

• Structural information:
  • Interpro: IPR019511  
• Other Databases: GeneCards:  AKAP7  Malacards:  AKAP7
• Protein general information: Q9P0M2  
  
  Name: A kinase anchor protein 7 isoform gamma (AKAP 7 isoform gamma) (A kinase anchor protein 18 kDa) (AKAP 18) (Protein kinase A anchoring protein 7 isoform gamma) (PRKA7 isoform gamma)
  
  Length: 348  Mass: 39518
  
  Tissue specificity: Expressed in brain, heart, lung, pancreas and placenta. {ECO
• Sequence: MERPEAGGINSNECENVSRKKKMSEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKK
  RKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLE
  LKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKL
  SKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSNGYYHCESSIVIGEKNGGEPDDAELVRLS
  KRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
• Structural information:

  Interpro:	IPR019511  IPR009097  IPR019510
  PDB:	4ZP3 5JJ2
  PDBsum:	4ZP3 5JJ2
  STRING:	ENSP00000405252

• Other Databases: GeneCards:  AKAP7  Malacards:  AKAP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0034237	protein kinase A regulatory subunit binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051018	protein kinase A binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0010738	regulation of protein kinase A signaling	IBA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray