• Gene id: 9463

Gene Summary

• Gene Symbol: PICK1   Gene   UCSC   Ensembl
• Aliases: PICK, PRKCABP
• Gene name: protein interacting with PRKCA 1
• Alternate names: PRKCA-binding protein, protein interacting with C kinase 1, protein kinase C-alpha-binding protein,
• Gene location: 22q13.1 (38056310: 38075703)     Exons: 14     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It
• OMIM: 605926

Protein Summary

• Protein general information: Q9NRD5  
  • Name: PRKCA binding protein (Protein interacting with C kinase 1) (Protein kinase C alpha binding protein)
  • Length: 415  
  • Mass: 46,600
• Sequence:

  MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNG
  RSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLV
  KRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLL
  KTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
  RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ
  EEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

• Structural information:
  • Protein Domains: PDZ. (22-105)
    AH. (144-357)
  • Interpro: IPR027267  IPR010504  IPR030798  IPR001478  IPR036034   IPR037959  
  • Prosite: PS50870 PS50106
  • CDD: cd07659
  • PDB: 2GZV 6BJN 6BJO
  • PDBsum: 2GZV 6BJN 6BJO
  • STRING: ENSP00000349465
• Other Databases: GeneCards:  PICK1  Malacards:  PICK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001664	G-protein coupled receptor binding	ISS	molecular function
GO:0002092	positive regulation of receptor internalization	ISS	biological process
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0005102	receptor binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	NAS	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0015844	monoamine transport	IDA	biological process
GO:0016887	ATPase activity	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019904	protein domain specific binding	ISS	molecular function
GO:0021782	glial cell development	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	ISS	biological process
GO:0036294	cellular response to decreased oxygen levels	ISS	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0042734	presynaptic membrane	IDA	cellular component
GO:0042802	identical protein binding	ISS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0043045	DNA methylation involved in embryo development	NAS	biological process
GO:0043046	DNA methylation involved in gamete generation	TAS	biological process
GO:0043113	receptor clustering	ISS	biological process
GO:0045161	neuronal ion channel clustering	TAS	biological process
GO:0045202	synapse	ISS	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0051015	actin filament binding	ISS	molecular function
GO:0060292	long term synaptic depression	ISS	biological process
GO:0071933	Arp2/3 complex binding	ISS	molecular function
GO:0097061	dendritic spine organization	ISS	biological process
GO:0097062	dendritic spine maintenance	ISS	biological process
GO:0001664	G-protein coupled receptor binding	ISS	molecular function
GO:0002092	positive regulation of receptor internalization	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0005102	receptor binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	NAS	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0015844	monoamine transport	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016887	ATPase activity	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0019904	protein domain specific binding	ISS	molecular function
GO:0021782	glial cell development	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	ISS	biological process
GO:0036294	cellular response to decreased oxygen levels	ISS	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0042734	presynaptic membrane	IDA	cellular component
GO:0042802	identical protein binding	ISS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0043045	DNA methylation involved in embryo development	NAS	biological process
GO:0043046	DNA methylation involved in gamete generation	TAS	biological process
GO:0043113	receptor clustering	ISS	biological process
GO:0045161	neuronal ion channel clustering	TAS	biological process
GO:0045202	synapse	ISS	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051015	actin filament binding	ISS	molecular function
GO:0060292	long term synaptic depression	ISS	biological process
GO:0071933	Arp2/3 complex binding	ISS	molecular function
GO:0097061	dendritic spine organization	ISS	biological process
GO:0097062	dendritic spine maintenance	ISS	biological process
GO:0001664	G-protein coupled receptor binding	ISS	molecular function
GO:0002092	positive regulation of receptor internalization	ISS	biological process
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0005102	receptor binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	NAS	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0015844	monoamine transport	IDA	biological process
GO:0016887	ATPase activity	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019904	protein domain specific binding	ISS	molecular function
GO:0021782	glial cell development	ISS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	ISS	biological process
GO:0036294	cellular response to decreased oxygen levels	ISS	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0042734	presynaptic membrane	IDA	cellular component
GO:0042802	identical protein binding	ISS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0043045	DNA methylation involved in embryo development	NAS	biological process
GO:0043046	DNA methylation involved in gamete generation	TAS	biological process
GO:0043113	receptor clustering	ISS	biological process
GO:0045161	neuronal ion channel clustering	TAS	biological process
GO:0045202	synapse	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0051015	actin filament binding	ISS	molecular function
GO:0060292	long term synaptic depression	ISS	biological process
GO:0071933	Arp2/3 complex binding	ISS	molecular function
GO:0097061	dendritic spine organization	ISS	biological process
GO:0097062	dendritic spine maintenance	ISS	biological process

Diseases

Associated diseases	References
Schizophrenia	GAD: 17367885
Psychological disorders	GAD: 19086053
Male factor infertility	MIK: 21397063
Acrosomal defects	MIK: 20562896
Globozoospermia	MIK: 21397063
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Globozoospermia	MIK: 21397063
Male infertility	MIK: 26306493
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20562896	Globozoospermia, Lack of acrosome	G198A in exon 13 of the PICK1	Chinese	3 patients with globozoospermia type I	Male infertility	Gopc Hrb Csnk2a2 Pick1
21397063	Globozoospermia	DPY19L2 deletion			Male infertility	DPY19L2 SPATA16 PICK1
19258705	Role in acrosome biogenesis, Male infertility				Male infertility
26306493	Globozoospermia, Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R