• Gene id: 9456

Gene Summary

• Gene Symbol: HOMER1   Gene   UCSC   Ensembl
• Aliases: HOMER, HOMER1A, HOMER1B, HOMER1C, SYN47, Ves-1
• Gene name: homer scaffold protein 1
• Alternate names: homer protein homolog 1, homer homolog 1, homer scaffolding protein 1, homer, neuronal immediate early gene, 1, homer-1,
• Gene location: 5q14.1 (79514133: 79372635)     Exons: 10     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. [provided by RefSeq, Jul 2008]
• OMIM: 604798

Protein Summary

• Protein general information: Q86YM7  
  • Name: Homer protein homolog 1 (Homer 1)
  • Length: 354  
  • Mass: 40277
• Sequence:

  MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFG
  QWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
  ERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERL
  HKRVTELECVSSQANAVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
  LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS

• Structural information:
  • Protein Domains: (1..11-)
    (/note="WH1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00410"-)
  • Interpro: IPR011993  IPR000697  
  • Prosite: PS50229
  • STRING: ENSP00000334382
• Other Databases: GeneCards:  HOMER1  Malacards:  HOMER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IBA	cellular component
GO:0035256	G protein-coupled glutamate receptor binding	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IBA	biological process
GO:0014069	postsynaptic density	IBA	cellular component
GO:2001256	regulation of store-operated calcium entry	IBA	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0051262	protein tetramerization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0044309	neuron spine	ISS	cellular component
GO:1902950	regulation of dendritic spine maintenance	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007206	phospholipase C-activating G protein-coupled glutamate receptor signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098962	regulation of postsynaptic neurotransmitter receptor activity	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0090279	regulation of calcium ion import	IEA	biological process
GO:0051928	positive regulation of calcium ion transport	IEA	biological process
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0048148	behavioral response to cocaine	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:2001257	regulation of cation channel activity	IEA	biological process
GO:2001256	regulation of store-operated calcium entry	IEA	biological process
GO:0099524	postsynaptic cytosol	IEA	cellular component
GO:0048875	chemical homeostasis within a tissue	IEA	biological process
GO:0043034	costamere	IEA	cellular component
GO:0030018	Z disc	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003009	skeletal muscle contraction	IEA	biological process
GO:0035591	signaling adaptor activity	IC	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0051592	response to calcium ion	IDA	biological process
GO:0009967	positive regulation of signal transduction	IC	biological process
GO:2001256	regulation of store-operated calcium entry	TAS	biological process
GO:2001257	regulation of cation channel activity	TAS	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04724	Glutamatergic synapse
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq