• Gene id: 9450

Gene Summary

• Gene Symbol: LY86   Gene   UCSC   Ensembl
• Aliases: MD-1, MD1, MMD-1, dJ80N2.1
• Gene name: lymphocyte antigen 86
• Alternate names: lymphocyte antigen 86, MD-1, RP105-associated, ly-86, protein MD-1,
• Gene location: 6p25.1 (112990952: 113001968)     Exons: 6     NC_000003.12
• OMIM: 605241

Protein Summary

• Protein general information: O95711  
  • Name: Lymphocyte antigen 86 (Ly 86) (Protein MD 1)
  • Length: 162  
  • Mass: 17906
  • Tissue specificity: Highly expressed in B-cells, monocytes and tonsil.
• Sequence:

  MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILR
  EDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS
  TVACANATIMCS

• Structural information:
  • Interpro: IPR014756  IPR039945  IPR003172  
  • PDB: 3B2D
  • PDBsum: 3B2D
  • DIP: 59105
  • STRING: ENSP00000369286
• Other Databases: GeneCards:  LY86  Malacards:  LY86

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0031666	positive regulation of lipopolysaccharide-mediated signaling pathway	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031666	positive regulation of lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0006955	immune response	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R