• Gene id: 945

Gene Summary

• Gene Symbol: CD33   Gene   UCSC   Ensembl
• Aliases: SIGLEC-3, SIGLEC3, p67
• Gene name: CD33 molecule
• Alternate names: myeloid cell surface antigen CD33, CD33 antigen (gp67), CD33 molecule transcript, gp67, sialic acid-binding Ig-like lectin 3,
• Gene location: 19q13.41 (51211053: 51240015)     Exons: 14     NC_000019.10
• OMIM: 610694

Protein Summary

• Protein general information: P20138  
  • Name: Myeloid cell surface antigen CD33 (Sialic acid binding Ig like lectin 3) (Siglec 3) (gp67) (CD antigen CD33)
  • Length: 364  
  • Mass: 39825
  • Tissue specificity: Monocytic/myeloid lineage cells. In the brain, CD33 is mainly expressed on microglial cells.
• Sequence:

  MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVAT
  NKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIP
  GTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTER
  TIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH
  PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ

• Structural information:
  • Protein Domains: (19..13-)
    (/note="Ig-like-V-type)
    (145..22-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR013151  
  • Prosite: PS50835
  • PDB: 5IHB 5J06 5J0B 6D48 6D49 6D4A
  • PDBsum: 5IHB 5J06 5J0B 6D48 6D49 6D4A
  • STRING: ENSP00000262262
• Other Databases: GeneCards:  CD33  Malacards:  CD33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150102	negative regulation of monocyte activation	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0033691	sialic acid binding	IMP	molecular function
GO:0033691	sialic acid binding	IMP	molecular function
GO:0098609	cell-cell adhesion	IMP	biological process
GO:0098609	cell-cell adhesion	IMP	biological process
GO:1903615	positive regulation of protein tyrosine phosphatase activity	IMP	biological process
GO:0051926	negative regulation of calcium ion transport	IMP	biological process
GO:0032691	negative regulation of interleukin-1 beta production	IMP	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IMP	biological process
GO:0032717	negative regulation of interleukin-8 production	IMP	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0033691	sialic acid binding	IBA	molecular function
GO:0002765	immune response-inhibiting signal transduction	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881