About Us

Search Result


Gene id 9448
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol MAP4K4   Gene   UCSC   Ensembl
Aliases FLH21957, HEL-S-31, HGK, MEKKK4, NIK
Gene name mitogen-activated protein kinase kinase kinase kinase 4
Alternate names mitogen-activated protein kinase kinase kinase kinase 4, HPK/GCK-like kinase HGK, MAPK/ERK kinase kinase kinase 4, MEK kinase kinase 4, Ste20 group protein kinase HGK, epididymis secretory protein Li 31, hepatocyte progenitor kinase-like/germinal center kinase-,
Gene location 2q11.2 (101697702: 101894689)     Exons: 33     NC_000002.12
Gene summary(Entrez) The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of
OMIM 604666

Protein Summary

Protein general information O95819  

Name: Mitogen activated protein kinase kinase kinase kinase 4 (EC 2.7.11.1) (HPK/GCK like kinase HGK) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (Nck interacting kinase)

Length: 1239  Mass: 142101

Tissue specificity: Widely expressed. Isoform 5 is abundant in the brain. Isoform 4 is predominant in the liver, skeletal muscle and placenta. {ECO

Sequence MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKK
YSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVI
HRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIE
MAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQL
LQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEELERRRKEEEE
RRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQ
HDHRRPHPQHSQQPPPPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRS
ESFSNGNSESVHPALQRPAEPQVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRP
GSGSSSGSSNSGSQPGSHPGSQSGSGERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPADLTALAKELR
AVEDVRPPHKVTDYSSSSEESGTTDEEDDDVEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVHDDVESEP
AMTPSKEGTLIVRQTQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGS
VVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEG
LNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAW
APKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIIL
PNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRA
QRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW
Structural information
Protein Domains
(25..28-)
(/note="Protein-kinase)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
(926..121-)
(/note="CNH-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00795"-)
Interpro:  IPR001180  IPR011009  IPR000719  IPR017441  IPR008271  
Prosite:   PS50219 PS00107 PS50011 PS00108

PDB:  
4OBO 4OBP 4OBQ 4RVT 4U3Y 4U3Z 4U40 4U41 4U42 4U43 4U44 4U45 4ZK5 4ZP5 5DI1 5J95 5W5Q
PDBsum:   4OBO 4OBP 4OBQ 4RVT 4U3Y 4U3Z 4U40 4U41 4U42 4U43 4U44 4U45 4ZK5 4ZP5 5DI1 5J95 5W5Q
MINT:  
STRING:   ENSP00000343658
Other Databases GeneCards:  MAP4K4  Malacards:  MAP4K4

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0008017 microtubule binding
IDA molecular function
GO:0005925 focal adhesion
IDA cellular component
GO:0120183 positive regulation of fo
cal adhesion disassembly
ISS biological process
GO:0043547 positive regulation of GT
Pase activity
ISS biological process
GO:0001953 negative regulation of ce
ll-matrix adhesion
NAS biological process
GO:0030335 positive regulation of ce
ll migration
IMP biological process
GO:0051549 positive regulation of ke
ratinocyte migration
ISS biological process
GO:0051894 positive regulation of fo
cal adhesion assembly
ISS biological process
GO:0032014 positive regulation of AR
F protein signal transduc
tion
ISS biological process
GO:0004111 creatine kinase activity
IDA molecular function
GO:0043066 negative regulation of ap
optotic process
IMP biological process
GO:0023014 signal transduction by pr
otein phosphorylation
IBA biological process
GO:0031098 stress-activated protein
kinase signaling cascade
IBA biological process
GO:0004674 protein serine/threonine
kinase activity
IBA molecular function
GO:0005737 cytoplasm
IBA cellular component
GO:0007346 regulation of mitotic cel
l cycle
IBA biological process
GO:0032147 activation of protein kin
ase activity
IBA biological process
GO:0048812 neuron projection morphog
enesis
IBA biological process
GO:0046328 regulation of JNK cascade
IDA biological process
GO:0005737 cytoplasm
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0004672 protein kinase activity
IEA molecular function
GO:0005524 ATP binding
IEA molecular function
GO:0006468 protein phosphorylation
IEA biological process
GO:0016740 transferase activity
IEA molecular function
GO:0016301 kinase activity
IEA molecular function
GO:0016310 phosphorylation
IEA biological process
GO:0000166 nucleotide binding
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0004674 protein serine/threonine
kinase activity
IEA molecular function
GO:0005524 ATP binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0006468 protein phosphorylation
IDA biological process
GO:0004674 protein serine/threonine
kinase activity
IDA molecular function
GO:0035556 intracellular signal tran
sduction
IDA biological process
GO:0005524 ATP binding
IDA molecular function
GO:0030033 microvillus assembly
IMP NOT|biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04010MAPK signaling pathway
Associated diseases References
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract