• Gene id: 9443

Gene Summary

• Gene Symbol: MED7   Gene   UCSC   Ensembl
• Aliases: ARC34, CRSP33, CRSP9
• Gene name: mediator complex subunit 7
• Alternate names: mediator of RNA polymerase II transcription subunit 7, CRSP complex subunit 9, RNA polymerase transcriptional regulation mediator subunit 7 homolog, activator-recruited cofactor 34 kDa component, cofactor required for Sp1 transcriptional activation subunit 9, ,
• Gene location: 5q33.3 (157142864: 157137423)     Exons: 3     NC_000005.10
• Gene summary(Entrez): The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. T
• OMIM: 605045

Protein Summary

• Protein general information: O43513  
  • Name: Mediator of RNA polymerase II transcription subunit 7 (hMED7) (Activator recruited cofactor 34 kDa component) (ARC34) (Cofactor required for Sp1 transcriptional activation subunit 9) (CRSP complex subunit 9) (Mediator complex subunit 7) (RNA polymerase tr
  • Length: 233  
  • Mass: 27245
• Sequence:

  MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHK
  KELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETA
  ERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVL
  IDEMNERP

• Structural information:
  • Interpro: IPR037212  IPR009244  
  • STRING: ENSP00000286317
• Other Databases: GeneCards:  MED7  Malacards:  MED7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016592	mediator complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016592	mediator complex	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0016592	mediator complex	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray