• Gene id: 9442

Gene Summary

• Gene Symbol: MED27   Gene   UCSC   Ensembl
• Aliases: CRAP34, CRSP34, CRSP8, MED3, TRAP37
• Gene name: mediator complex subunit 27
• Alternate names: mediator of RNA polymerase II transcription subunit 27, CRSP complex subunit 8, cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa, epididymis secretory sperm binding protein, p37 TRAP/SMCC/PC2 subunit, transcriptional coactivator CRSP34,
• Gene location: 9q34.13 (132079866: 131860109)     Exons: 11     NC_000009.12
• Gene summary(Entrez): The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. T
• OMIM: 603799

Protein Summary

• Protein general information: Q6P2C8  
  • Name: Mediator of RNA polymerase II transcription subunit 27 (Cofactor required for Sp1 transcriptional activation subunit 8) (CRSP complex subunit 8) (Mediator complex subunit 27) (P37 TRAP/SMCC/PC2 subunit) (Transcriptional coactivator CRSP34)
  • Length: 311  
  • Mass: 35432
• Sequence:

  MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSN
  LVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKA
  QPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTED
  GKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFR
  TLEAFHDTCRQ

• Structural information:
  • Interpro: IPR021627  
  • DIP: 31465
  • STRING: ENSP00000292035
• Other Databases: GeneCards:  MED27  Malacards:  MED27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016592	mediator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq