• Gene id: 944

Gene Summary

• Gene Symbol: TNFSF8   Gene   UCSC   Ensembl
• Aliases: CD153, CD30L, CD30LG, TNLG3A
• Gene name: TNF superfamily member 8
• Alternate names: tumor necrosis factor ligand superfamily member 8, CD153 antigen, CD30 antigen ligand, CD30 ligand, CD30-L, tumor necrosis factor (ligand) superfamily, member 8, tumor necrosis factor ligand 3A, tumor necrosis factor superfamily member 8,
• Gene location: 9q32-q33.1 (114930673: 114893342)     Exons: 6     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancie
• OMIM: 120550

Protein Summary

• Protein general information: P32971  
  • Name: Tumor necrosis factor ligand superfamily member 8 (CD30 ligand) (CD30 L) (CD antigen CD153)
  • Length: 234  
  • Mass: 26017
• Sequence:

  MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNV
  PLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQ
  CPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVL
  SIFLYSNSD

• Structural information:
  • Interpro: IPR021185  IPR021184  IPR006052  IPR008983  
  • Prosite: PS00251 PS50049
  • CDD: cd00184
  • DIP: 2929
  • STRING: ENSP00000223795
• Other Databases: GeneCards:  TNFSF8  Malacards:  TNFSF8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043374	CD8-positive, alpha-beta T cell differentiation	IBA	biological process
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043374	CD8-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042129	regulation of T cell proliferation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881