• Gene id: 9435

Gene Summary

• Gene Symbol: CHST2   Gene   UCSC   Ensembl
• Aliases: C6ST, GST-2, GST2, Gn6ST-1, HEL-S-75, glcNAc6ST-1
• Gene name: carbohydrate sulfotransferase 2
• Alternate names: carbohydrate sulfotransferase 2, N-acetylglucosamine 6-O-sulfotransferase 1, carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, carbohydrate (chondroitin 6/keratan) sulfotransferase 2, epididymis secretory protein Li 75, galactose/N-acetylglucosamine/N,
• Gene location: 3q24 (143119770: 143124013)     Exons: 2     NC_000003.12
• Gene summary(Entrez): This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen. [provided by RefSeq, Aug 2011]
• OMIM: 604800

Protein Summary

• Protein general information: Q9Y4C5  
  • Name: Carbohydrate sulfotransferase 2 (EC 2.8.2. ) (Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 2) (GST 2) (N acetylglucosamine 6 O sulfotransferase 1) (GlcNAc6ST 1) (Gn6ST 1)
  • Length: 530  
  • Mass: 57857
  • Tissue specificity: Widely expressed. Highly expressed in bone marrow, peripheral blood leukocytes, spleen, brain, spinal cord, ovary and placenta. Expressed by high endothelial cells (HEVs) and leukocytes. {ECO
• Sequence:

  MSRSPQRALPPGALPRLLQAAPAAAPRALLPQWPRRPGRRWPASPLGMKVFRRKALVLCAGYALLLVLTMLNLLD
  YKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAAAGMAGVAAPP
  GNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYR
  CDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRT
  LVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHK
  LGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPE
  MEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLL
  RKPRL

• Structural information:
  • Interpro: IPR016469  IPR027417  IPR000863  
  • STRING: ENSP00000307911
• Other Databases: GeneCards:  CHST2  Malacards:  CHST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0006790	sulfur compound metabolic process	IBA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IBA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006044	N-acetylglucosamine metabolic process	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	molecular function
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	molecular function
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0031228	intrinsic component of Golgi membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00533	Glycosaminoglycan biosynthesis - keratan sulfate

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq