• Gene id: 94274

Gene Summary

• Gene Symbol: PPP1R14A   Gene   UCSC   Ensembl
• Aliases: CPI-17, CPI17, PPP1INL
• Gene name: protein phosphatase 1 regulatory inhibitor subunit 14A
• Alternate names: protein phosphatase 1 regulatory subunit 14A, 17 kDa PKC-potentiated inhibitory protein of PP1, 17-KDa protein, PKC-potentiated inhibitory protein of PP1, protein kinase C-potentiated inhibitor protein of 17 kDa,
• Gene location: 19q13.2 (38256373: 38251236)     Exons: 4     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads
• OMIM: 608153

Protein Summary

• Protein general information: Q96A00  
  • Name: Protein phosphatase 1 regulatory subunit 14A (17 kDa PKC potentiated inhibitory protein of PP1) (Protein kinase C potentiated inhibitor protein of 17 kDa) (CPI 17)
  • Length: 147  
  • Mass: 16693
  • Tissue specificity: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. {ECO
• Sequence:

  MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEI
  NIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQDRARTAHP

• Structural information:
  • Interpro: IPR008025  IPR036658  
  • STRING: ENSP00000301242
• Other Databases: GeneCards:  PPP1R14A  Malacards:  PPP1R14A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0042325	regulation of phosphorylation	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004865	protein serine/threonine phosphatase inhibitor activity	IBA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0035690	cellular response to drug	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04270	Vascular smooth muscle contraction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)