• Gene id: 94241

Gene Summary

• Gene Symbol: TP53INP1   Gene   UCSC   Ensembl
• Aliases: SIP, TP53DINP1, TP53INP1A, TP53INP1B, Teap, p53DINP1
• Gene name: tumor protein p53 inducible nuclear protein 1
• Alternate names: tumor protein p53-inducible nuclear protein 1, p53-dependent damage-inducible nuclear protein 1, p53-inducible p53DINP1, stress-induced protein,
• Gene location: 8q22.1 (94949377: 94925971)     Exons: 6     NC_000008.11
• OMIM: 606185

Protein Summary

• Protein general information: Q96A56  
  • Name: Tumor protein p53 inducible nuclear protein 1 (Stress induced protein) (p53 dependent damage inducible nuclear protein 1) (p53DINP1)
  • Length: 240  
  • Mass: 27366
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLEC
  LADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDE
  LHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKH
  NGWVVHQPCPRQYNY

• Structural information:
  • Interpro: IPR029431  IPR029556  
  • STRING: ENSP00000344215
• Other Databases: GeneCards:  TP53INP1  Malacards:  TP53INP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005776	autophagosome	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048102	autophagic cell death	IMP	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016209	antioxidant activity	ISS	molecular function
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0010506	regulation of autophagy	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016209	antioxidant activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0016209	antioxidant activity	IEA	molecular function
GO:0034644	cellular response to UV	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0071361	cellular response to ethanol	IEA	biological process
GO:0072703	cellular response to methyl methanesulfonate	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0071447	cellular response to hydroperoxide	IEA	biological process
GO:1904761	negative regulation of myofibroblast differentiation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881