• Gene id: 9423

Gene Summary

• Gene Symbol: NTN1   Gene   UCSC   Ensembl
• Aliases: MRMV4, NTN1L
• Gene name: netrin 1
• Alternate names: netrin-1, epididymis tissue protein Li 131P, netrin 1, mouse, homolog of,
• Gene location: 17p13.1 (9021509: 9243999)     Exons: 8     NC_000017.11
• Gene summary(Entrez): Netrin is included in a family of laminin-related secreted proteins. The function of this gene has not yet been defined; however, netrin is thought to be involved in axon guidance and cell migration during development. Mutations and loss of expression o
• OMIM: 601614

Protein Summary

• Protein general information: O95631  
  • Name: Netrin 1 (Epididymis tissue protein Li 131P)
  • Length: 604  
  • Mass: 67748
  • Tissue specificity: Widely expressed in normal adult tissues with highest levels in heart, small intestine, colon, liver and prostate. Reduced expression in brain tumors and neuroblastomas. Expressed in epididymis (at protein level). {ECO
• Sequence:

  MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA
  RYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQ
  FCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDG
  RPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
  SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNT
  AGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAP
  CIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGT
  SRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
  CKKA

• Structural information:
  • Protein Domains: (47..28-)
    (/note="Laminin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00466-)
    (285..34-)
    1 (/note="Laminin-EGF-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00460-)
    (341..40-)
    2 (/note="Laminin-EGF-like)
    (/evidence="ECO:-)
  • Interpro: IPR008979  IPR002049  IPR008211  IPR038684  IPR001134   IPR018933  IPR008993  
  • Prosite: PS00022 PS01248 PS50027 PS51117 PS50189
  • PDB: 4URT 6FKQ
  • PDBsum: 4URT 6FKQ
  • DIP: 46273
  • STRING: ENSP00000173229
• Other Databases: GeneCards:  NTN1  Malacards:  NTN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005604	basement membrane	IBA	cellular component
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0016358	dendrite development	IBA	biological process
GO:0008045	motor neuron axon guidance	IBA	biological process
GO:0009888	tissue development	IBA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:2000147	positive regulation of cell motility	ISS	biological process
GO:0045773	positive regulation of axon extension	ISS	biological process
GO:0032488	Cdc42 protein signal transduction	ISS	biological process
GO:0007265	Ras protein signal transduction	ISS	biological process
GO:0006930	substrate-dependent cell migration, cell extension	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:1902842	negative regulation of netrin-activated signaling pathway	TAS	biological process
GO:1902842	negative regulation of netrin-activated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0051963	regulation of synapse assembly	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0030334	regulation of cell migration	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007097	nuclear migration	IEA	biological process
GO:0005604	basement membrane	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0061643	chemorepulsion of axon	IEA	biological process
GO:0060603	mammary gland duct morphogenesis	IEA	biological process
GO:0033564	anterior/posterior axon guidance	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0061643	chemorepulsion of axon	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq