• Gene id: 942

Gene Summary

• Gene Symbol: CD86   Gene   UCSC   Ensembl
• Aliases: B7-2, B7.2, B70, CD28LG2, LAB72
• Gene name: CD86 molecule
• Alternate names: T-lymphocyte activation antigen CD86, B-lymphocyte activation antigen B7-2, BU63, CD86 antigen (CD28 antigen ligand 2, B7-2 antigen), CTLA-4 counter-receptor B7.2, FUN-1,
• Gene location: 3q13.33 (122055361: 122121142)     Exons: 8     NC_000003.12
• Gene summary(Entrez): This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymph
• OMIM: 601020

SNPs

rs12870438

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000013.11   g.42906069G>A
NC_000013.10   g.43480205G>A
NG_051573.1   g.91244C>T|SEQ=[G/A]|GENE=EPSTI1

rs144944885

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000022.11   g.50776483del
NC_000022.10   g.51214911del
NW_004070876.1   g.11558del|SEQ=[G/-]|GENE=RABL2B
RPL23AP82   284942

Protein Summary

• Protein general information: P42081  
  • Name: T lymphocyte activation antigen CD86 (Activation B7 2 antigen) (B70) (BU63) (CTLA 4 counter receptor B7.2) (FUN 1) (CD antigen CD86)
  • Length: 329  
  • Mass: 37682
  • Tissue specificity: Expressed by activated B-lymphocytes and monocytes.
• Sequence:

  MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKF
  DSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITEN
  VYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKT
  RLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
  IHIPERSDEAQRVFKSSKTSSCDKSDTCF

• Structural information:
  • Protein Domains: (33..13-)
    (/note="Ig-like-V-type)
    (150..22-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR037677  IPR007110  IPR036179  IPR013783  IPR003599   IPR013106  
  • Prosite: PS50835
  • CDD: cd16087
  • PDB: 1I85 1NCN 5YXK
  • PDBsum: 1I85 1NCN 5YXK
  • DIP: 35606
  • STRING: ENSP00000332049
• Other Databases: GeneCards:  CD86  Malacards:  CD86

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0031295	T cell costimulation	IBA	biological process
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0007202	activation of phospholipase C activity	ISS	biological process
GO:0023035	CD40 signaling pathway	ISS	biological process
GO:1990051	activation of protein kinase C activity	ISS	biological process
GO:0002377	immunoglobulin production	ISS	biological process
GO:0042113	B cell activation	ISS	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	ISS	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0005886	plasma membrane	NAS	cellular component
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0015026	coreceptor activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045630	positive regulation of T-helper 2 cell differentiation	NAS	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	NAS	biological process
GO:0043017	positive regulation of lymphotoxin A biosynthetic process	NAS	biological process
GO:0045404	positive regulation of interleukin-4 biosynthetic process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05202	Transcriptional misregulation in cancer
hsa04514	Cell adhesion molecules
hsa05322	Systemic lupus erythematosus
hsa04620	Toll-like receptor signaling pathway
hsa05323	Rheumatoid arthritis
hsa05416	Viral myocarditis
hsa04672	Intestinal immune network for IgA production
hsa05320	Autoimmune thyroid disease
hsa04940	Type I diabetes mellitus
hsa05332	Graft-versus-host disease
hsa05330	Allograft rejection

Diseases

Associated diseases	References
Chronic lymphocytic leukemia	PMID:23154584
Henoch-Schoenlein purpura	PMID:27030970
aplastic anemia	PMID:21234821
Multiple sclerosis	PMID:26531698
Asthma	PMID:9449507
Asthma	PMID:17513529
Cryoglobulinemia	PMID:23840845
Chronic obstructive pulmonary disease	PMID:19729666
Chronic obstructive pulmonary disease	PMID:20732370
systemic scleroderma	PMID:16790753
Pulmonary hypertension	PMID:19693657
Autoimmune thrombocytopenic purpura	PMID:19379594
Autoimmune thrombocytopenic purpura	PMID:20581660
acute myeloid leukemia	PMID:16115907
multiple myeloma	PMID:22705596
type 1 diabetes mellitus	PMID:16232222
type 1 diabetes mellitus	PMID:12742378
type 1 diabetes mellitus	PMID:17947667
acute lymphocytic leukemia	PMID:24283754
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)