• Gene id: 9419

Gene Summary

• Gene Symbol: CRIPT   Gene   UCSC   Ensembl
• Aliases: HSPC139, SSMDF
• Gene name: CXXC repeat containing interactor of PDZ3 domain
• Alternate names: cysteine-rich PDZ-binding protein, cysteine-rich interactor of PDZ three, cysteine-rich interactor of PDZ3, postsynaptic protein CRIPT,
• Gene location: 2p21 (46617214: 46630175)     Exons: 3     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies. [provi
• OMIM: 604594

Protein Summary

• Protein general information: Q9P021  
  • Name: Cysteine rich PDZ binding protein (Cysteine rich interactor of PDZ three) (Cysteine rich interactor of PDZ3)
  • Length: 101  
  • Mass: 11216
• Sequence:

  MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQG
  CAYKKGICAMCGKKVLDTKNYKQTSV

• Structural information:
  • Interpro: IPR019367  
  • DIP: 41219
  • STRING: ENSP00000238892
• Other Databases: GeneCards:  CRIPT  Malacards:  CRIPT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030165	PDZ domain binding	IBA	molecular function
GO:0008017	microtubule binding	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902897	regulation of postsynaptic density protein 95 clustering	IEA	biological process
GO:0031122	cytoplasmic microtubule organization	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0045184	establishment of protein localization	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0035372	protein localization to microtubule	IEA	biological process
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0097110	scaffold protein binding	IDA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0030165	PDZ domain binding	IDA	molecular function
GO:0043198	dendritic shaft	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0035372	protein localization to microtubule	ISS	biological process
GO:1902897	regulation of postsynaptic density protein 95 clustering	ISS	biological process
GO:0031122	cytoplasmic microtubule organization	ISS	biological process
GO:0045184	establishment of protein localization	ISS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0044877	protein-containing complex binding	ISS	molecular function
GO:0014069	postsynaptic density	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0008017	microtubule binding	ISS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)