• Gene id: 94120

Gene Summary

• Gene Symbol: SYTL3   Gene   UCSC   Ensembl
• Aliases: SLP3
• Gene name: synaptotagmin like 3
• Alternate names: synaptotagmin-like protein 3, exophilin-6,
• Gene location: 6q25.3 (158644866: 158766297)     Exons: 1     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to a family of peripheral membrane proteins that play a role in vesicular trafficking. This protein binds phospholipids in the presence of calcium ions. Alternatively spliced transcript variants encoding different

Protein Summary

• Protein general information: Q4VX76  
  • Name: Synaptotagmin like protein 3 (Exophilin 6)
  • Length: 610  
  • Mass: 68560
• Sequence:

  MAQEIDLSALKELEREAILQVLYRDQAVQNTEEERTRKLKTHLQHLRWKGAKNTDWEHKEKCCARCQQVLGFLLH
  RGAVCRGCSHRVCAQCRVFLRGTHAWKCTVCFEDRNVKIKTGEWFYEERAKKFPTGGKHETVGGQLLQSYQKLSK
  ISVVPPTPPPVSESQCSRSPGRLQEFGQFRGFNKSVENLFLSLATHVKKLSKSQNDMTSEKHLLATGPRQCVGQT
  ERRSQSDTAVNVTTRKVSAPDILKPLNQEDPKCSTNPILKQQNLPSSPAPSTIFSGGFRHGSLISIDSTCTEMGN
  FDNANVTGEIEFAIHYCFKTHSLEICIKACKNLAYGEEKKKKCNPYVKTYLLPDRSSQGKRKTGVQRNTVDPTFQ
  ETLKYQVAPAQLVTRQLQVSVWHLGTLARRVFLGEVIIPLATWDFEDSTTQSFRWHPLRAKAEKYEDSVPQSNGE
  LTVRAKLVLPSRPRKLQEAQEGTDQPSLHGQLCLVVLGAKNLPVRPDGTLNSFVKGCLTLPDQQKLRLKSPVLRK
  QACPQWKHSFVFSGVTPAQLRQSSLELTVWDQALFGMNDRLLGGTRLGSKGDTAVGGDACSLSKLQWQKVLSSPN
  LWTDMTLVLH

• Structural information:
  • Protein Domains: (4..12-)
    (/note="RabBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00234-)
    (306..42-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (462..60-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR041282  IPR010911  IPR028704   IPR011011  IPR013083  
  • Prosite: PS50004 PS50916
  • STRING: ENSP00000483936
• Other Databases: GeneCards:  SYTL3  Malacards:  SYTL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0042043	neurexin family protein binding	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0005543	phospholipid binding	IEA	molecular function
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042043	neurexin family protein binding	IEA	molecular function
GO:0012505	endomembrane system	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq