• Gene id: 9412

Gene Summary

• Gene Symbol: MED21   Gene   UCSC   Ensembl
• Aliases: SRB7, SURB7, hSrb7
• Gene name: mediator complex subunit 21
• Alternate names: mediator of RNA polymerase II transcription subunit 21, RNA polymerase II holoenzyme component SRB7, RNAPII complex component SRB7, SRB7 suppressor of RNA polymerase B homolog,
• Gene location: 12p11.23 (34915828: 34996127)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the mediator complex subunit 21 family. The encoded protein interacts with the human RNA polymerase II holoenzyme and is involved in transcriptional regulation of RNA polymerase II transcribed genes. A pseudogene of this gene
• OMIM: 603800

Protein Summary

• Protein general information: Q13503  
  • Name: Mediator of RNA polymerase II transcription subunit 21 (Mediator complex subunit 21) (RNA polymerase II holoenzyme component SRB7) (RNAPII complex component SRB7) (hSrb7)
  • Length: 144  
  • Mass: 15564
• Sequence:

  MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDIDVLIDS
  LPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS

• Structural information:
  • Interpro: IPR037212  IPR021384  
  • DIP: 31471
  • STRING: ENSP00000282892
• Other Databases: GeneCards:  MED21  Malacards:  MED21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0016592	mediator complex	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0016592	mediator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0016592	mediator complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016592	mediator complex	IEA	cellular component
GO:0001824	blastocyst development	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0032774	RNA biosynthetic process	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881