• Gene id: 941

Gene Summary

• Gene Symbol: CD80   Gene   UCSC   Ensembl
• Aliases: B7, B7-1, B7.1, BB1, CD28LG, CD28LG1, LAB7
• Gene name: CD80 molecule
• Alternate names: T-lymphocyte activation antigen CD80, B-lymphocyte activation antigen B7, CD80 antigen (CD28 antigen ligand 1, B7-1 antigen), CTLA-4 counter-receptor B7.1, activation B7-1 antigen, costimulatory factor CD80, costimulatory molecule variant IgV-CD80,
• Gene location: 3q13.33 (119559613: 119524292)     Exons: 7     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may pl

Protein Summary

• Protein general information: P33681  
  • Name: T lymphocyte activation antigen CD80 (Activation B7 1 antigen) (BB1) (CTLA 4 counter receptor B7.1) (B7) (CD antigen CD80)
  • Length: 288  
  • Mass: 33048
  • Tissue specificity: Expressed on activated B-cells, macrophages and dendritic cells.
• Sequence:

  MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLT
  MMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDF
  EIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRV
  NQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV

• Structural information:
  • Protein Domains: (35..13-)
    (/note="Ig-like-V-type)
    (145..23-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR013162  IPR037676  IPR042711  IPR007110  IPR036179   IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • CDD: cd16083 cd16086
  • PDB: 1DR9 1I8L
  • PDBsum: 1DR9 1I8L
  • DIP: 6044
  • STRING: ENSP00000264246
• Other Databases: GeneCards:  CD80  Malacards:  CD80

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0031295	T cell costimulation	IBA	biological process
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0031295	T cell costimulation	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	NAS	cellular component
GO:0098636	protein complex involved in cell adhesion	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0045627	positive regulation of T-helper 1 cell differentiation	NAS	biological process
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0015026	coreceptor activity	NAS	molecular function
GO:0009967	positive regulation of signal transduction	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045425	positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process	NAS	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa05322	Systemic lupus erythematosus
hsa04620	Toll-like receptor signaling pathway
hsa05323	Rheumatoid arthritis
hsa05416	Viral myocarditis
hsa04672	Intestinal immune network for IgA production
hsa05320	Autoimmune thyroid disease
hsa04940	Type I diabetes mellitus
hsa05332	Graft-versus-host disease
hsa05330	Allograft rejection

Diseases

Associated diseases	References
Multiple sclerosis	PMID:21310664
Chronic obstructive pulmonary disease	PMID:19729666
Demyelinating disease	PMID:21310664
Rheumatoid arthritis	PMID:22917707
Systemic lupus erythematosus	PMID:20653937
type 1 diabetes mellitus	PMID:19658094
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray