• Gene id: 94097

Gene Summary

• Gene Symbol: SFXN5   Gene   UCSC   Ensembl
• Aliases: BBG-TCC, SLC56A5
• Gene name: sideroflexin 5
• Alternate names: sideroflexin-5,
• Gene location: 2p13.2 (73071711: 72942035)     Exons: 19     NC_000002.12
• OMIM: 606149

Protein Summary

• Protein general information: Q8TD22  
  • Name: Sideroflexin 5
  • Length: 340  
  • Mass: 37124
  • Tissue specificity: Primarily expressed in the brain. {ECO
• Sequence:

  MADTATTASAAAASAASASSDAPPFQLGKPRFQQTSFYGRFRHFLDIIDPRTLFVTERRLREAVQLLEDYKHGTL
  RPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTLASTVFWQWLNQSHNACVNYA
  NRNATKPSPASKFIQGYLGAVISAVSIAVGLNVLVQKANKFTPATRLLIQRFVPFPAVASANICNVVLMRYGELE
  EGIDVLDSDGNLVGSSKIAARHALLETALTRVVLPMPILVLPPIVMSMLEKTALLQARPRLLLPVQSLVCLAAFG
  LALPLAISLFPQMSEIETSQLEPEIAQATSSRTVVYNKGL

• Structural information:
  • Interpro: IPR004686  
  • STRING: ENSP00000272433
• Other Databases: GeneCards:  SFXN5  Malacards:  SFXN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990542	mitochondrial transmembrane transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0015746	citrate transport	IBA	biological process
GO:0031305	integral component of mitochondrial inner membrane	IBA	cellular component
GO:0015137	citrate transmembrane transporter activity	IBA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015075	ion transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015137	citrate transmembrane transporter activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0015746	citrate transport	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq