• Gene id: 9409

Gene Summary

• Gene Symbol: PEX16   Gene   UCSC   Ensembl
• Aliases: PBD8A, PBD8B
• Gene name: peroxisomal biogenesis factor 16
• Alternate names: peroxisomal biogenesis factor 16, peroxin 16, peroxisomal membrane protein PEX16, peroxisome biogenesis factor 16,
• Gene location: 11p11.2 (45918122: 45909662)     Exons: 11     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is an integral peroxisomal membrane protein. An inactivating nonsense mutation localized to this gene was observed in a patient with Zellweger syndrome of the complementation group CGD/CG9. Expression of this gene product
• OMIM: 607013

Protein Summary

• Protein general information: Q9Y5Y5  
  • Name: Peroxisomal membrane protein PEX16 (Peroxin 16) (Peroxisomal biogenesis factor 16)
  • Length: 336  
  • Mass: 38629
• Sequence:

  MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLLNDGILRKELRKKLPV
  SLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAKAVLRMLLLLWFKAGLQTSPPIVPLDRETQA
  QPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYI
  ARPLLHLLSLGLWGQRSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL
  FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG

• Structural information:
  • Interpro: IPR013919  
  • STRING: ENSP00000241041
• Other Databases: GeneCards:  PEX16  Malacards:  PEX16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0007031	peroxisome organization	IBA	biological process
GO:0007031	peroxisome organization	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016558	protein import into peroxisome matrix	IMP	biological process
GO:0005779	integral component of peroxisomal membrane	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0106101	ER-dependent peroxisome localization	IDA	biological process
GO:0032581	ER-dependent peroxisome organization	IDA	biological process
GO:0022615	protein to membrane docking	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0007031	peroxisome organization	IMP	biological process
GO:0007031	peroxisome organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0045046	protein import into peroxisome membrane	IMP	biological process
GO:0006625	protein targeting to peroxisome	IMP	biological process
GO:0016557	peroxisome membrane biogenesis	IMP	biological process
GO:0016557	peroxisome membrane biogenesis	IMP	biological process
GO:0005778	peroxisomal membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0007031	peroxisome organization	IBA	biological process
GO:0007031	peroxisome organization	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016558	protein import into peroxisome matrix	IMP	biological process
GO:0005779	integral component of peroxisomal membrane	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0106101	ER-dependent peroxisome localization	IDA	biological process
GO:0032581	ER-dependent peroxisome organization	IDA	biological process
GO:0022615	protein to membrane docking	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0007031	peroxisome organization	IMP	biological process
GO:0007031	peroxisome organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0045046	protein import into peroxisome membrane	IMP	biological process
GO:0006625	protein targeting to peroxisome	IMP	biological process
GO:0016557	peroxisome membrane biogenesis	IMP	biological process
GO:0016557	peroxisome membrane biogenesis	IMP	biological process
GO:0005778	peroxisomal membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq