• Gene id: 9406

Gene Summary

• Gene Symbol: ZRANB2   Gene   UCSC   Ensembl
• Aliases: ZIS, ZIS1, ZIS2, ZNF265
• Gene name: zinc finger RANBP2-type containing 2
• Alternate names: zinc finger Ran-binding domain-containing protein 2, zinc finger protein 265, zinc finger, RAN-binding domain containing 2, zinc-finger, splicing,
• Gene location: 1p31.1 (71081034: 71063290)     Exons: 11     NC_000001.11
• OMIM: 604347

Protein Summary

• Protein general information: O95218  
  • Name: Zinc finger Ran binding domain containing protein 2 (Zinc finger protein 265) (Zinc finger, splicing)
  • Length: 330  
  • Mass: 37404
• Sequence:

  MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCS
  NVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED
  KESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSSSRS
  RSRSRSRSSSSSQSRSRSSSRERSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSSPERNRKRSRSRSSSSGDRKK
  RRTRSRSPERRHRSSSGSSHSGSRSSSKKK

• Structural information:
  • Interpro: IPR017337  IPR001876  IPR036443  
  • Prosite: PS01358 PS50199
  • PDB: 1N0Z 2K1P 3G9Y
  • PDBsum: 1N0Z 2K1P 3G9Y
  • STRING: ENSP00000359958
• Other Databases: GeneCards:  ZRANB2  Malacards:  ZRANB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001530	lipopolysaccharide binding	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0008380	RNA splicing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R