• Gene id: 9404

Gene Summary

• Gene Symbol: LPXN   Gene   UCSC   Ensembl
• Aliases: LDPL
• Gene name: leupaxin
• Alternate names: leupaxin,
• Gene location: 11q12.1 (52707162: 52728589)     Exons: 15     NC_000014.9
• Gene summary(Entrez): The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-
• OMIM: 605390

Protein Summary

• Protein general information: O60711  
  • Name: Leupaxin
  • Length: 386  
  • Mass: 43332
  • Tissue specificity: Macrophages, monocytes and osteoclasts (at protein level). Strongly expressed in cells and tissues of hematopoietic origin. Highest expression in lymphoid tissues such as spleen, lymph node, thymus and appendix and in the vascular smoo
• Sequence:

  MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEA
  QEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKG
  HCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTA
  MNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
  TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTY
  CQPCFNKLFPL

• Structural information:
  • Protein Domains: (150..20-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (209..26-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (268..32-)
    3 (/note="LIM-zinc-binding)
    (/evidence="ECO-)
  • Interpro: IPR017305  IPR001781  
  • Prosite: PS00478 PS50023
  • PDB: 1X3H 4XEF 4XEK 4XEV
  • PDBsum: 1X3H 4XEF 4XEK 4XEV
  • STRING: ENSP00000431284
• Other Databases: GeneCards:  LPXN  Malacards:  LPXN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0050859	negative regulation of B cell receptor signaling pathway	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0002102	podosome	IDA	cellular component
GO:0050859	negative regulation of B cell receptor signaling pathway	IDA	biological process
GO:0007162	negative regulation of cell adhesion	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003712	transcription coregulator activity	IDA	molecular function
GO:0003712	transcription coregulator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0007155	cell adhesion	NAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002102	podosome	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0033628	regulation of cell adhesion mediated by integrin	IEA	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0002102	podosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903506	regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903506	regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903506	regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903506	regulation of nucleic acid-templated transcription	IEA	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq