• Gene id: 94032

Gene Summary

• Gene Symbol: CAMK2N2   Gene   UCSC   Ensembl
• Aliases: CAM-KIIN, CAMKIIN
• Gene name: calcium/calmodulin dependent protein kinase II inhibitor 2
• Alternate names: calcium/calmodulin-dependent protein kinase II inhibitor 2, CaM-KII inhibitory protein,
• Gene location: 3q27.1 (184261552: 184259212)     Exons: 2     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity th
• OMIM: 300382

Protein Summary

• Protein general information: Q96S95  
  • Name: Calcium/calmodulin dependent protein kinase II inhibitor 2 (CaM KII inhibitory protein) (CaM KIIN)
  • Length: 79  
  • Mass: 8658
  • Tissue specificity: Expressed in cell lines including hemopoietic cell lines and some tumor cell lines. Highly Expressed in stimulated dendritic cell (DC) and weakly expressed in unstimulated mature and immature DC. Highly expressed in kidney, liver, in c
• Sequence:

  MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKP
  PSGV

• Structural information:
  • Interpro: IPR026779  
  • STRING: ENSP00000296238
• Other Databases: GeneCards:  CAMK2N2  Malacards:  CAMK2N2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0008427	calcium-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0008427	calcium-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq