• Gene id: 94031

Gene Summary

• Gene Symbol: HTRA3   Gene   UCSC   Ensembl
• Aliases: Prsp, Tasp
• Gene name: HtrA serine peptidase 3
• Alternate names: serine protease HTRA3, high-temperature requirement factor A3, pregnancy-related serine protease, probable serine protease HTRA3,
• Gene location: 4p16.1 (8269711: 8307097)     Exons: 10     NC_000004.12
• OMIM: 615572

Protein Summary

• Protein general information: P83110  
  • Name: Serine protease HTRA3 (EC 3.4.21. ) (High temperature requirement factor A3) (Pregnancy related serine protease)
  • Length: 453  
  • Mass: 48608
  • Tissue specificity: Widely expressed, with highest levels in both adult and fetal heart, ovary, uterus placenta, and bladder. In the endometrium, expressed in epithelial glands and the stroma. Also present in leukocytes. Isoform 1 is predominant in heart
• Sequence:

  MQARALLLAALAALALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVCAASEGEPCGGPLDSPCGESLE
  CVRGLCRCRWSHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACPLGLHQLSSPRYKFNFIADVVEKI
  APAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKK
  SDIATIKIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQREGRELGLRDSDMDYIQTDAII
  NYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKAS
  NPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPE
  VVM

• Structural information:
  • Protein Domains: (21..7-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (64..12-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (359..44-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU-)
  • Interpro: IPR009030  IPR000867  IPR002350  IPR036058  IPR001478   IPR041489  IPR036034  IPR009003  IPR001940  
  • Prosite: PS51323 PS51465 PS50106
  • PDB: 2P3W 4RI0
  • PDBsum: 2P3W 4RI0
  • STRING: ENSP00000303766
• Other Databases: GeneCards:  HTRA3  Malacards:  HTRA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IDA	biological process
GO:0008236	serine-type peptidase activity	IDA	molecular function
GO:0030514	negative regulation of BMP signaling pathway	ISS	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq