• Gene id: 9403

Gene Summary

• Gene Symbol: SELENOF   Gene   UCSC   Ensembl
• Aliases: SEP15
• Gene name: selenoprotein F
• Alternate names: selenoprotein F, 15 kDa selenoprotein,
• Gene location: 1p22.3 (86914576: 86862444)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the SEP15/selenoprotein M family. The exact function of this protein is not known; however, it has been found to associate with UDP-glucose:glycoprotein glucosyltransferase (UGTR), an endoplasmic reticulum(ER)-r
• OMIM: 606254

Protein Summary

• Protein general information: O60613  
  • Name: Selenoprotein F (15 kDa selenoprotein)
  • Length: 165  
  • Mass: 18092
  • Tissue specificity: Higher levels in prostate and thyroid gland. {ECO
• Sequence:

  MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQ
  EEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWN
  TDSVEEFLSEKLERI

• Structural information:
  • Interpro: IPR038219  IPR039992  IPR014912  IPR036249  
  • STRING: ENSP00000328729
• Other Databases: GeneCards:  SELENOF  Malacards:  SELENOF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005788	endoplasmic reticulum lumen	IBA	cellular component
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0051084	'de novo' posttranslational protein folding	TAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881